KEGG   Pseudomonas syringae CC1557: N018_10740Help
Entry
N018_10740        CDS       T03014                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00550  Peptidoglycan biosynthesis
psyr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N018_10740
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    N018_10740
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psyr01011]
    N018_10740
Enzymes [BR:psyr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N018_10740
Peptidoglycan biosynthesis and degradation proteins [BR:psyr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   N018_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer MAP
Motif
Other DBs
NCBI-ProteinID: AHG40697
UniProt: W0MQH4
LinkDB All DBs
Position
2288969..2290858
Genome map
AA seq 629 aa AA seqDB search
MPNPIPLKDHEKETRLVNQRLIACAVLVGLLAICLVARMYFLQVTEFEYHSTISENNRVH
VLPIPPERGLIFDRNGEVLADNRPSFNLTLTRERAGDWHKVIDELMTLLELPDEDRILFD
KELKQVRHPFEPATLLYELTEEQIAILAVNQYLLPGVDVAAQFVRHYPLGAHFAHSIGYV
GRINEKEAAQLDNDYRGTQSIGKTGIERFYESELHGRVGYEEVETNAQGRVLRVLKHTDP
VPGKNITLSLDAHLQEAAENALGDRRGSVVALDPETGEVLAMVSKPSFDPNLFVTGISFK
QYAALRDSIDRPLFNRVLRGLYAPGSTVKPEVAIAGLDSGVVNASTKVFDPGYFQLPDFD
HKYRNWNHSGDGWVDMDTAIMRSNDTYFYTLAHKLGIDRLHDYMTMFGIGQKVSLDMFEE
SAGLMPSREWKRATRRQAWFPGETVILGIGQGYMQVTPLQLAQATSLIASKGVWHRPHLA
MEVGNVAPVDEHPMPNIVLHDPNEWNQVNTGMQMVMHDPRGIARDAAKGAQYRIAGKSGT
AQVVAIKQGERYNRLKTLERNRDNALFVGFAPADHPKIVVSVTIENGEAGGRVAGPVVRE
ILDAWLLDSDGKLKPQYAVPTKATGNPHA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatccaatccccttgaaagaccacgagaaagagacgcggctggtcaaccagcgc
ttgattgcctgtgccgtattggtcgggctgctggcgatctgtctggtcgcgcggatgtat
ttcctgcaagtcaccgaatttgaataccactcgaccatttctgaaaacaaccgtgtgcat
gtgctgcccattccgcctgaacgcggtctgatcttcgaccgtaatggcgaggtgcttgcc
gataaccggcccagcttcaacctgaccctgacccgtgagcgcgccggagactggcacaag
gtgatcgatgagttgatgacgctgctggagttgcctgacgaggatcgcatcctgttcgac
aaggagctgaagcaggtgcgccatccgttcgagcccgcgacattgctgtacgaactgact
gaagagcagatcgccatactggcggtcaatcagtacctcctgcctggagtggatgtagcc
gcgcagtttgttcgtcattacccgctgggcgcgcattttgcccattcgatcggttatgtc
gggcgcatcaacgaaaaagaagccgcccaactcgacaatgattatcgcggcactcagtcg
atcggcaagaccggtatcgaacggttttacgagtctgaactgcacggccgggtcggctat
gaagaagttgaaaccaacgcgcaggggcgcgtgctgcgggttctgaagcataccgatccg
gtgccgggcaagaacatcaccctgagtctggatgcgcatttgcaggaagcggccgagaac
gcgctgggtgatcggcgcggttcggtggtggcgctggacccggaaacaggtgaagtgctg
gcgatggtcagcaaaccgagcttcgatcccaacctgttcgtgaccggtatcagcttcaag
caatacgccgcgctgcgtgactccatcgaccggccgctgttcaaccgagtactgcgtggc
ctgtatgccccaggttcgacggtcaagccggaggtcgccattgccgggctcgacagcggt
gtcgtcaacgcctcgaccaaggtcttcgaccccggttacttccagttgccggacttcgat
cacaagtaccgcaactggaaccacagtggcgacggctgggtggacatggacacggcgatc
atgcgttccaacgacacctacttctacaccctggcgcacaagctgggcattgaccgactg
catgactacatgaccatgttcggcatcggccagaaggtctcgctggatatgttcgaagaa
tccgccggcctgatgccgtctcgcgagtggaagcgcgctacacgccgtcaggcctggttc
cccggcgagacagtgattctcggcatcggtcagggctacatgcaggtcaccccgttgcaa
ctggcccaggccacctcgctgatcgccagcaagggcgtttggcatcgcccgcacctggcg
atggaagtgggcaatgtagcgccggtcgacgagcatccgatgccgaatatcgtgctgcat
gaccccaatgaatggaatcaggtcaacaccggcatgcaaatggtcatgcacgacccgcgt
ggtattgcgcgtgatgcggcaaagggtgcgcaatatcgcatcgctggcaagagcggtacg
gcgcaggtggtggcgatcaagcagggcgagcgttacaaccgtctcaaaacccttgagcgt
aaccgcgataacgccctgtttgttggcttcgctccggccgatcacccgaaaatcgtggtg
tcagtgaccatcgagaacggcgaggcgggcggccgagtggcaggcccggtggtgcgcgaa
attctcgatgcctggctgctcgacagcgacggcaaactcaagccgcaatacgcagtgccc
accaaggcgacgggcaacccgcacgcctga

DBGET integrated database retrieval system