KEGG   Pseudomonas syringae CC1557: N018_11280Help
Entry
N018_11280        CDS       T03014                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00440  Phosphonate and phosphinate metabolism
psyr01100  Metabolic pathways
psyr01120  Microbial metabolism in diverse environments
psyr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    N018_11280
Enzymes [BR:psyr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     N018_11280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL ComA DAGK_prokar
Motif
Other DBs
NCBI-ProteinID: AHG40796
UniProt: W0MVD5
LinkDB All DBs
Position
complement(2430083..2430943)
Genome map
AA seq 286 aa AA seqDB search
MSIQAKLLANKKTQFMEAHNGLSAKIVEQTGFEAIWASGLSMSASMGLSDRNEASWSQVL
NVLEQMSDNVDIPILVDGDSGFGNYINVIRFVKKLKQIGVHAVCIEDKLFPKTNSFIGEN
QDLASIEEFSNKIKAAKDTGGGEFTVVARVEALISGKSMEEALERAHAYRDAGADAILIH
SKKKDAHEVFEFATRWSGKSPIFAVPTKYYRTDYSEFVNHGINNLIWANHLIRSSIRSMK
ETAQTIYQEKSLINIENNVSSLEELFSLTNERHMEELESLYDKSSR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagtatccaagcaaaattactggccaacaaaaaaactcaattcatggaagctcacaac
ggcctgagcgccaaaattgtcgagcaaacaggctttgaggccatttgggcatcaggtctt
tcaatgagcgcctcgatggggctttctgatcgcaacgaggcgtcctggtcccaggtattg
aatgttttggaacagatgtcggataacgtcgatatccctattctggtggacggcgattcc
gggttcggaaactacatcaatgtgattcggttcgttaagaagctcaaacagatcggtgtt
cacgccgtgtgtattgaggacaagcttttccccaaaaccaattcttttattggcgaaaat
caggacttggcctcgattgaggagttcagtaacaaaatcaaggcagccaaagataccggc
ggcggcgagttcactgttgttgcccgcgtggaagcccttatctccggaaaatccatggag
gaagcacttgagcgcgcacatgcttaccgagatgcaggcgcggatgcgatacttatccac
tccaagaaaaaagacgcgcatgaggtgtttgagtttgcaacacgctggtctggaaagtcg
cccatcttcgccgtgccgaccaagtattaccgcacagactacagtgagttcgtcaatcac
ggtatcaacaatctgatctgggcgaatcacctcatccgcagttcgatacgcagtatgaaa
gaaacggcgcagaccatttatcaggaaaagtccctgatcaatatagaaaacaatgtgtct
tcgcttgaagaactgttttcattaacgaacgagcgccacatggaagaactcgaaagtctt
tacgacaagtcttcccgctga

DBGET integrated database retrieval system