KEGG   Pseudomonas syringae CC1557: N018_11685Help
Entry
N018_11685        CDS       T03014                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psyr  Pseudomonas syringae CC1557
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    N018_11685
Enzymes [BR:psyr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     N018_11685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO HI0933_like AlaDh_PNT_C Thi4 Glutaredoxin FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AHG40871
UniProt: W0MVL8
LinkDB All DBs
Position
2514171..2515733
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGTDAR
TPSFSLSSPGHDISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRALQGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPGIKHVAIDGALFQDEVTDRKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKDAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADKLIPGVAGQL
HEVKFASGASLKTKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDEQ
KVNGLRYKSRTTGEEITVPLEGIFVQIGLLPNSEWLRGAIELSPRGEIVVDSRGETSVPG
IFAAGDVTVAPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctacctggagcgggtcactcgcccc
atcgagatcgtcgcgtcccttgatgacggcgcgaagtctcaggaaatgctcgcactgctc
aatgacgtgatcagcgtttccaaagacgtcaccctgaatgacagcggcaccgacgcgcgt
actccgtcgttctcgctgagcagccctggacacgatatcagcctgcgtttcgccggtatc
cccatgggtcacgaattcacctcgctggtcctggcgctgctgcaagttggcggctaccca
cccaaggtcagtgcggaaaccatcgaacaggttcgcgcccttcaaggcgagttccatttc
gaaacctatttctcccagtcctgccagaactgtcctgacgttgttcaggcgctgaatctg
atggcagtgctgaaccctggcatcaagcacgtcgctatcgatggtgcgctgttccaggac
gaagtcaccgatcgcaagatcatgtcggtgcccagcatctacctgaatggcgaactgttc
ggccagggccgtatgggcctggaagagattctggccaagatcgacacgggtgccggtgcg
cgtcaggccgagaagctcaatgccaaagacgcgtttgacgtgttggtagtaggcggcggt
cctgctggttcggcggctgccgtctatgcagctcgcaaaggtattcgtaccggtgtggcg
gctgagcgctttggcggtcaggtgctggacaccatggccatcgaaaacttcatctcggta
cagcacactgaggggccgaaactggccgtggcgcttgaagaacacgtgaagcagtacgaa
gtcgacatcatgaacctgcaacgcgccgacaagctgattcctggtgtagccggtcagttg
catgaagttaaatttgccagcggcgcgagcctcaagaccaagaccgtcatccttgccacc
ggcgcacgctggagggagatgaacgttcccggcgagcagcaataccgcaacaagggcgtg
gcgtactgcccgcattgtgacggtccgttgttcaagggcaagcgcgttgccgtaattggt
ggcggtaactccggcgttgaagccgccatcgacctggcgggcatcgtgtcccatgtcact
ctgctggagttcgacgtgcagttgcgcgccgacgctgtcttgcagcgcaaactgcacagc
ctgcctaacgtcaccgtgatcaccagtgcgcagaccactgaagtgaccggcgacgagcag
aaggtcaacggcctgcgctacaagagccgcaccactggcgaagaaatcaccgttccgctg
gaaggtatcttcgtccagatcggcctgctgcctaacagcgaatggctcagaggcgctatc
gagttgtcgccacgtggcgagatcgtggtggattcgcgcggcgaaacatcagtgccgggc
atcttcgcagccggcgacgtcaccgtagcaccttacaagcagatcatcatcgccctgggc
gagggtgccaaggcctccttgagcgcgttcgaccacctgatccgcacttctgcaccagcc
tga

DBGET integrated database retrieval system