KEGG   Pseudomonas syringae CC1557: N018_15545Help
Entry
N018_15545        CDS       T03014                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr00010  Glycolysis / Gluconeogenesis
psyr00052  Galactose metabolism
psyr01100  Metabolic pathways
psyr01110  Biosynthesis of secondary metabolites
psyr01120  Microbial metabolism in diverse environments
psyr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N018_15545
   00052 Galactose metabolism
    N018_15545
Enzymes [BR:psyr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     N018_15545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AHG41532
UniProt: W0MSZ2
LinkDB All DBs
Position
3458479..3459627
Genome map
AA seq 382 aa AA seqDB search
MKKHALLSTFGLSLMISTLTAQAAALSSEHSSFGQLPDGTAVEKYTLRNSHGVQASIITY
GATLQSLLVPDKAGKVEDIVLGFDDVQGYQNNGTVYFGATIGRFGNRLAGGKFTLDGKTY
QVPLNDKTNALHGGDKGFDKRLWKAQETKTGDSVGVKLTYVSPDGEMGFPGTLQTEVTYS
LNDKNELKIDYRATTDKPTVLNLTNHSYFNLAGAGSGDVLKQVATLHASHYTPVNDKLIP
TGELPAVAGTPMDFLKPTAFGKHIKDDNQQLKYAEPKQGGFDFNWVLDSKGDVKKLAAEV
SDPQSGRTLQLFTTEPGVQLYTGNFLDGSIHGKGGKVYPHWGAFTLETQHYPDAPNQPKF
PSTRLDPGKAYTQTTVFKFLNN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcatgctcttctcagcacctttggactgtctttgatgatcagcaccttgacc
gcacaggccgcagcactctccagcgaacacagctcctttggccaactgccggacggcacc
gccgtcgaaaaatacaccctgcgcaacagccatggtgtgcaggccagcatcatcacctat
ggcgcgaccctgcaatcactgctggtacccgacaaggctggcaaggtggaagacatcgtg
ctgggcttcgatgacgtgcagggctatcagaacaacggtacggtgtatttcggtgcgacc
atcggacgtttcggcaaccgcctggcgggtggcaaattcaccctcgatggaaagacctat
caggtcccgctcaacgacaagaccaacgctcttcatggtggcgacaagggtttcgacaaa
cgcctgtggaaagcgcaggaaaccaagaccggtgattcagtcggcgtgaagctgacctac
gtgtcgccagacggcgagatgggcttcccgggaacgctgcagaccgaagtcacctacagc
cttaacgacaagaacgagctgaaaatcgattaccgcgccaccaccgacaaaccgacggtg
ttgaacctgaccaaccacagctatttcaatctggcgggcgcaggcagcggcgatgttctc
aaacaggttgccaccctgcacgcttcgcattacaccccggtcaacgacaagctgatcccg
accggcgaactgcccgccgtggccggcacgccgatggacttcctcaagcccactgcgttc
ggcaagcacataaaggatgacaaccaacagctcaagtacgccgaacccaagcaaggcggc
tttgacttcaactgggtactggacagtaaaggggatgtgaagaaactggccgccgaggtc
agcgacccgcagtcaggccggacactgcagctgttcaccaccgagcctggcgtgcagctg
tacaccggcaacttcctggatggcagcatccacggcaagggcggcaaggtctacccgcat
tggggcgcgtttacgctggaaacccagcattaccctgatgcacccaaccagccgaaattc
ccgagcactcgactggaccctggcaaggcttacacccagacaactgtgttcaaattcctc
aataactga

DBGET integrated database retrieval system