KEGG   Pseudomonas syringae CC1557: N018_16280Help
Entry
N018_16280        CDS       T03014                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psyr  Pseudomonas syringae CC1557
Pathway
psyr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psyr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    N018_16280 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psyr03400]
    N018_16280 (ligD)
Enzymes [BR:psyr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     N018_16280 (ligD)
DNA repair and recombination proteins [BR:psyr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     N018_16280 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme ParE_toxin
Motif
Other DBs
NCBI-ProteinID: AHG41670
UniProt: W0MWS7
LinkDB All DBs
Position
complement(3615927..3618518)
Genome map
AA seq 863 aa AA seqDB search
MAKPASEYTRKRNFNVTSEPAESKRKGKARSSALSFVIQKHDARNLHYDFRLELDGTLKS
WAVPKGPSLDPKQKRLAVHVEDHPLDYAGFEGSIPQGQYGGGDVIVWDRGIWQPHGDPQK
TYEEGKLKFTLVGEKLSGEWALVRTRLKGSGSKEQWLLIKEKDSIARPADEYDITQEQPQ
SVISGAHVGAGRAASAKPKPKPGNATSKAKAATPKVAASKAEPKRAKTAIPDALSPQLAT
LVDAPPAGEWLYEIKFDGYRMLTRIQDDEVRLFTRNGNDWTDQLPELVKALKGLKLQDSW
FDGEVVVLDEQGLPDFQGLQNAFDEGQSKNILYYLFDMPFLSGEDLREVPLEQRRDALKQ
VLGSQRSRVLRYSDAFQAGHQDIVASAAAMGLEGVIGKRAGSAYVSKRNPDWIKLKCRLR
QEFVIVGYTAPQGSRSAFGALLLAVNDAKQGLVYAGRVGTGFNEATLKQLHKQLQPLQRE
TSPLAKKLSAAQARGVQWLEPQLVCEAEFAQWTREGILRQAAFVGLRTDKPASDVVHEQA
QPAKAVSKTKVASAAPKTGKKTAQGKVDVSGTGISHPDRVIDSKTGTQKIELAQFYASIA
EWILPYLNKRPVALLRCPEGIDGEQFFQKHAEHLAIPNIKQLDRALDPGHAALMEIDSVQ
ALVGATQMGAIELHTWGATRDKIETPDHLVLDLDPDPALPWRSMIEATQMVLAVLDELGL
EAFLKTSGGKGMHIIVPLARQADWDTVKAFSKAIAEFVSRQLPERFTATMGPKNRVGKIF
VDYLRNSRGGSTVTAYSVRARPGLPVSVPIALDELAGLTSSAQWDITTLEQRLSTLKDDP
WAGYSNRRKITQKMWKQLGAKQP
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccagccagtgaatacacacgcaagcgcaattttaatgtcacctcagagcct
gccgagagcaaacgcaaaggcaaggcgcggtccagcgcgctgagctttgtgattcaaaaa
cacgatgcgcgtaatctgcactacgacttccgcctggaactggatggcacgctcaagagc
tgggcggttcctaaaggtccaagcctggacccgaagcaaaagcgtctggcggtgcatgtc
gaggatcatccgctggattacgccggtttcgagggcagcattccgcaagggcaatacggc
ggaggcgacgtaattgtctgggatcggggcatctggcagccccatggcgatccgcaaaag
acttacgaggaaggcaagctcaagttcacgctggtcggcgagaagctcagcggcgagtgg
gcgctggtacgcacgcggctcaaaggcagcggcagtaaggaacaatggctgctgatcaag
gaaaaggactcgattgcccgacccgccgacgagtacgacatcacccaggaacaaccacaa
agcgtgatcagcggcgcgcatgtcggggccgggcgtgcagcgtctgccaagcccaagccc
aagcccggcaatgcaaccagtaaggccaaggctgcaacgccaaaagttgcagcatcaaaa
gccgagccgaaaagagccaaaacagcgatcccggatgcgttgtcgccacaactggcaacg
ctggtggatgccccgcccgcaggtgagtggctgtacgagatcaagttcgacggctaccgc
atgctcacgcgcatccaggatgacgaagtgcgtctgttcacccgtaacggcaatgactgg
accgatcaactgcctgaactggtcaaggcccttaaaggcttgaagttgcaggacagctgg
ttcgacggcgaagtggtggtgctcgacgaacaagggttgcccgactttcagggcctgcag
aatgcctttgatgaggggcaaagcaagaacatcctgtattacctgttcgacatgccgttt
ctgagtggcgaagatttgcgcgaagtgccactggaacagcgtcgtgacgccttgaaacag
gtgctcggcagccagcgcagccgcgtgctgcgctactccgatgcgtttcaggccgggcat
caggacattgttgccagcgccgctgcaatgggcctcgaaggggtgatcggcaaacgtgcc
ggcagcgcctatgtgagcaagcgcaatcccgactggatcaagctcaaatgccgtttgcgt
caggagtttgtgatcgtcggctataccgcgccgcagggcagccgctcggcgttcggcgcg
ttgttgctggcggtcaatgacgccaagcaaggcctggtgtacgccgggcgggtcggcact
ggcttcaacgaagcgacactcaagcaattgcacaaacagttacagccgttgcagcgcgag
acctcgccgctggcaaaaaaactgagcgcagcgcaggcgcgaggtgtgcaatggttggag
ccacagctggtctgcgaagcagagtttgcccagtggacccgcgagggtattctgcgtcag
gccgcattcgtcggcttgcgcactgacaagcctgcaagcgatgtggtgcatgaacaggcc
cagccggcgaaggctgtcagcaaaaccaaggtcgcttcagccgctcccaaaacgggtaaa
aaaaccgctcagggcaaagtcgacgtatcaggaactggcatcagccatccggatcgggtc
atcgacagcaagaccggtacgcagaagattgaactcgcgcagttttacgcgtccattgcc
gaatggattctgccttatctgaacaagcgtccggtggcactcttgcgctgtcctgaaggc
atcgatggcgagcagtttttccagaagcacgccgagcatctggccattccaaatatcaag
cagcttgatcgcgcactggaccccggtcatgccgcgctgatggaaatcgactcggtgcag
gcgctggtcggtgcgacgcaaatgggtgccatcgaattgcatacctggggcgcgacccgc
gacaaaatcgagacgcctgatcacctggtactcgacctcgatccggacccggcgctgcct
tggcggagcatgatcgaggccacccagatggtacttgccgtgcttgatgagctgggcctg
gaagcttttctgaagaccagtggcggcaagggcatgcacatcatcgtgccgttggcgcgg
caggccgactgggacaccgtcaaggcgttttccaaggcgattgccgagtttgtcagtcgg
caactgcccgagcgctttacggccaccatggggccgaaaaaccgggtcgggaagatcttt
gtcgattacctgcgcaacagtcgcggcggcagtacagtcaccgcctattcggtacgcgcc
cggccgggtttaccggtctcggtgccgattgcactggatgagctggcgggtctgacgtcg
tcggcgcagtgggacatcaccacgcttgagcagcgtttaagcacgctcaaggatgaccct
tgggcgggctacagcaaccgccgaaaaatcacgcaaaagatgtggaagcagttgggtgcc
aaacagccttga

DBGET integrated database retrieval system