KEGG   Pseudomonas syringae CC1557: N018_19885Help
Entry
N018_19885        CDS       T03014                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psyr  Pseudomonas syringae CC1557
Brite
Enzymes [BR:psyr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N018_19885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHG42356
UniProt: W0MZU7
LinkDB All DBs
Position
complement(4403352..4403870)
Genome map
AA seq 172 aa AA seqDB search
MKTHLWLGLLGAFSISAQAASLDVPIDMVSADGAPKSIGSVTVSETEYGLLFTPKLTGLP
AGIHGFHVHENGSCEAGTKDGVKVAALAAGGHFDPAKTGKHLGPYADGHLGDLPALYVTA
DGKADYPVLAPRLKKLSEIKGHALMVHAGGDNHADMPKPLGGGGDRAACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcatctatggctgggcctgctcggcgctttttccatcagtgcgcaggcggca
tcgctggacgtgcctatcgatatggtcagcgccgacggcgcgcccaaatccatcggcagc
gtgactgtcagcgaaaccgaatacggtttgctgtttaccccgaaactgaccggtctgcct
gcgggcatccatggttttcatgtgcatgaaaacggcagctgcgaagcgggcaccaaggac
ggcgtcaaggttgcagcgctggccgcaggcgggcacttcgacccagccaagaccggcaaa
cacctcggcccttacgcagatggccatttgggtgacctgcctgccctttatgtcacggcc
gacggcaaggcggactatccggtactggcaccgcgcctgaagaaactgtccgaaatcaaa
ggccacgcgctgatggtccacgcgggcggtgataaccacgccgatatgcccaagccgctg
ggcggtggtggtgatcgcgcagcttgcggggtgatctga

DBGET integrated database retrieval system