KEGG   Psychrobacter sp. YP14: DLE54_01315Help
Entry
DLE54_01315       CDS       T05488                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psyy  Psychrobacter sp. YP14
Pathway
psyy00020  Citrate cycle (TCA cycle)
psyy00190  Oxidative phosphorylation
psyy00650  Butanoate metabolism
psyy01100  Metabolic pathways
psyy01110  Biosynthesis of secondary metabolites
psyy01120  Microbial metabolism in diverse environments
psyy01130  Biosynthesis of antibiotics
psyy01200  Carbon metabolism
Module
psyy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psyy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psyy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psyy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DLE54_01315
   00650 Butanoate metabolism
    DLE54_01315
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DLE54_01315
Enzymes [BR:psyy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DLE54_01315
    1.3.5.4  fumarate reductase (quinol)
     DLE54_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 Thi4 GIDA FAD_binding_3 Pyr_redox_3 HI0933_like FAD_oxidored Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AWT48300
LinkDB All DBs
Position
306567..308417
Genome map
AA seq 616 aa AA seqDB search
MATRQDNTISNIKTLNYDSVIVGGGGSGMRAALQLAEGGMKVAVITKVFPTRSHTVAAQG
GIGASLGNMSDDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHMGMPFDRNPD
GTIYQRPFGGHTSNYGEKAVQRACAAADRTGHALLHTLYQKNLEAGTEFFIEWIALDLIK
DEKGDINGVVAIEQETGTVAVFQATNTVLATGGAGRIFSASTNAYINTGDGLGMAVRAGI
PLQDMEFWQFHPTGVFGAGVLLTEGCRGEGAILRNKDGEAFMERYAPTVKDLAPRDLVSR
SMDQEIKEGRGCGPNKDHIVMDMTHLGVETIMKRLPSVFEIGKNFANVDITKEPIPVIPT
IHYMMGGIPTTIHGQVIVPDLDGHVDEEGLYTEGKIVKGLYAIGECACVSVHGANRLGTN
SLLDLVVFGRAAGKHIIDNFGSSDHNYHPMNPRVLDFTVGRLNKLQQSTQGYNAQEVADE
IRALMQKHASVFRTQALMDEGVEKLLALKDKVDNIHLADKSQVFNTARIEALEVANLYEV
AKATMLSAAKRHECRGAHTVLDYDRPEDDPIAPNGRNDNEWMKHTVWYSEGNKIVYKPVR
KVPLTVDYVEPKVRVY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcaactagacaagacaatacaattagtaatattaaaaccctaaattatgactctgtt
atcgttggcggtggcggctcaggtatgcgtgcagcgctgcaattagcagaaggcggcatg
aaagtagctgttattaccaaagtattcccaacccgctcgcacaccgttgcagctcaaggt
ggtattggggcaagcttaggtaacatgagtgatgacaactggcacttccacttttatgac
accgtaaaagggtcagactggttgggtgaccaagacgctatcgaatttatgtgccgtgaa
gcgccaaaagtagtgtatgagcttgagcacatgggtatgccgtttgaccgcaacccagat
ggtacgatttatcagcgtccattcggtggtcacacttcaaactacggtgaaaaagcggta
caacgtgcttgtgcggccgctgaccgtactggccacgcattactacacactctatatcaa
aagaacttagaagcgggtactgagtttttcatcgaatggatcgcgctcgatcttattaaa
gatgaaaaaggcgacatcaatggtgtggtagccattgagcaagaaaccggcactgttgcc
gtattccaagccactaataccgtattagcgacgggtggtgcaggtcgtatcttctcagct
tctaccaacgcttacatcaataccggtgacggcctaggtatggcagtacgtgctggtatt
ccattacaagatatggaattctggcaattccaccccaccggtgtattcggtgcaggtgta
cttcttactgaaggttgccgcggtgaaggcgctatcttacgtaacaaagatggtgaagcc
ttcatggagcgttatgcaccaacggttaaagacttggcacctcgtgacctagtatcacgc
tcaatggaccaagagattaaagaaggccgtggttgtggtccaaacaaagatcacatcgta
atggacatgactcacttaggtgttgagaccattatgaagcgtctgccttctgtattcgag
attggtaagaactttgccaacgtcgacattactaaagagcctatcccagttatcccaacc
atccactatatgatgggcggtattccaaccaccattcatggtcaggttatcgtgccagat
cttgacggtcatgtggatgaagaaggcctatacacagaaggcaaaatcgttaaaggctta
tacgccattggtgagtgtgcttgtgtgagtgttcacggtgccaaccgtttaggtaccaac
tcattacttgacttggtggtattcggccgtgctgcgggcaaacacatcattgataacttc
ggtagctcagatcataactaccatccaatgaacccccgtgtactagacttcactgtgggc
cgtttgaacaagctacaacagtcaacacaaggctataacgctcaagaagtggctgatgaa
atccgcgccctaatgcaaaaacacgccagtgtattccgcactcaagcgttgatggatgaa
ggtgttgagaagttattggctctaaaagataaagtagataacattcatttggcagataag
tcgcaagtgttcaacaccgcgcgtattgaagccttagaagttgctaacctttacgaagtg
gccaaagccaccatgctatcagcggccaagcgtcatgaatgtcgcggcgcgcataccgtg
ttagattatgatcgtccagaagatgatccaatcgcaccaaacggccgtaacgataacgag
tggatgaagcatactgtttggtactcagaaggcaataagattgtttataagccggttcgt
aaagtaccgcttactgttgattacgttgaacctaaagtgcgtgtttactaa

DBGET integrated database retrieval system