KEGG   Psychrobacter sp. YP14: DLE54_01320Help
Entry
DLE54_01320       CDS       T05488                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
psyy  Psychrobacter sp. YP14
Pathway
psyy00020  Citrate cycle (TCA cycle)
psyy00190  Oxidative phosphorylation
psyy00650  Butanoate metabolism
psyy01100  Metabolic pathways
psyy01110  Biosynthesis of secondary metabolites
psyy01120  Microbial metabolism in diverse environments
psyy01130  Biosynthesis of antibiotics
psyy01200  Carbon metabolism
Module
psyy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psyy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psyy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psyy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DLE54_01320 (sdhB)
   00650 Butanoate metabolism
    DLE54_01320 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DLE54_01320 (sdhB)
Enzymes [BR:psyy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DLE54_01320 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     DLE54_01320 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AWT48301
LinkDB All DBs
Position
308546..309256
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTIEIYRYDPDKDAAPYMQTYTIELLDSDRMLLDVLLRLKKQDESITFRRSCREG
ICGSDGVNINGKNGLACLINMNTLPEKITIRPLPGLPVVRDLVVDMNQFYEQYEKVHPYL
INDQPAPPTERLQSPEDREKLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFV
ADSRDSDTQARLARMDDPFSLFRCRGIMNCVAVCPKGLNPTRAIGHLRNLLLEQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaggtactcgcaccattgagatttaccgctacgatcctgataaggacgcagcc
ccttacatgcaaacttatacgattgagctgttagactcagatcgtatgttgcttgacgtt
ttattacgtttgaaaaaacaagatgaatccatcacctttagacgctcatgccgtgaaggt
atttgtggctctgatggggtgaacatcaatggtaaaaacggcttggcatgtttgattaac
atgaacactttgcctgagaaaattaccattcgtccactacctggcctgcctgttgtgcgt
gaccttgttgtggatatgaaccagttttatgagcagtatgaaaaagtacatccgtactta
atcaacgatcagcctgcaccgcctactgagcgtctacaatctccagaagatcgtgagaag
ctaaacggtctgtatgagtgtatcttatgtgcgtgctgttcaaccagctgcccatcattc
tggtggaaccctgataagttcttaggcccatcagcgctattgaacgcttatcgcttcgtg
gcagacagccgtgatagtgatacgcaagcgcgtcttgctcgtatggacgatccgtttagc
ttattccgttgccgtggtatcatgaactgtgtggccgtatgtccaaaaggcttgaaccca
acccgtgctatcggtcatttacgtaacttgttattagagcaggccggttaa

DBGET integrated database retrieval system