KEGG   Psychrobacter sp. YP14: DLE54_02695Help
Entry
DLE54_02695       CDS       T05488                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psyy  Psychrobacter sp. YP14
Pathway
psyy00473  D-Alanine metabolism
psyy00550  Peptidoglycan biosynthesis
psyy01100  Metabolic pathways
psyy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psyy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DLE54_02695
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DLE54_02695
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DLE54_02695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psyy01011]
    DLE54_02695
Enzymes [BR:psyy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DLE54_02695
Peptidoglycan biosynthesis and degradation proteins [BR:psyy01011]
 Precursor biosynthesis
  Amino acid ligase
   DLE54_02695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 TTL ATP-grasp_3 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AWT48551
LinkDB All DBs
Position
622997..623995
Genome map
AA seq 332 aa AA seqDB search
MPMTMTQSATNPTATPVSATKASANAATTQDPSIFGKVAVVFGGNSNERAVSLDSGNAVL
QALQSQGIDATHFDPKDQDVTELKNYDRVFNVLHGRGGEDGQLQGLLDWLGLPQTGSGVL
ASAIGMDKVRTKQLWHGCGLSTAPFAVLGADTDWQQIVNTLGLPLIVKPVHEGSSIGMSK
VNTLDELPKAYEVAAGCGDVVMAEKWITGREFTIVIIDDEAYPVIRLQPADISNFYDYEA
KYNRNDTQYHIPCGLSAEEEAHLQALSLAAFKAVDAKGWGRIDAMQDEEGNFWLLEINTV
PGMTSHSLVPMAAKARGMNFEQLCWHILAQTL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgactatgactcaatctgctaccaacccaactgcaacccctgtatctgctacc
aaagcttctgctaacgccgccacgactcaagatccaagcatctttggtaaagtcgccgtg
gtctttgggggtaatagcaatgagcgagcagtgtcattagacagtggcaatgcggtatta
caggcgctacagtcacagggtatcgatgccactcattttgatcctaaagaccaagatgtg
actgaattaaaaaattacgaccgtgtatttaatgtgctacatggccgcggcggtgaagat
ggtcagttacaaggcctgctagattggctgggtctaccccagacaggatccggtgttttg
gcatcagcgattggtatggacaaagtacgtactaagcaattgtggcacggctgtggatta
tctactgcgccttttgcagtattgggcgctgacacagactggcagcaaatcgttaatact
ttgggtctgcctttaattgtaaagccagtgcatgaaggctcaagtattggtatgagcaag
gtgaatacgttagatgagctgccaaaagcctatgaagtggcagcagggtgtggtgatgtg
gtgatggcagaaaaatggattactggccgtgagtttaccatcgttattatcgatgatgag
gcttatccagttattcgcctgcagcctgcagacatctccaatttctacgattatgaggcc
aaatacaatcgtaacgatactcagtaccatattccttgtggcttaagcgcagaagaagaa
gcacatttacaggcactaagcttggcggcatttaaggcagtagacgccaaaggctggggc
cgtattgatgctatgcaagacgaagaaggtaacttttggctattagagattaataccgta
cctggtatgaccagtcacagcttagtacctatggcagctaaagcacgtgggatgaatttt
gaacagctatgttggcatatcttagcccagactctgtaa

DBGET integrated database retrieval system