KEGG   Psychrobacter sp. YP14: DLE54_02825Help
Entry
DLE54_02825       CDS       T05488                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
psyy  Psychrobacter sp. YP14
Pathway
psyy00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:psyy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DLE54_02825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psyy01002]
    DLE54_02825
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psyy01011]
    DLE54_02825
Enzymes [BR:psyy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DLE54_02825
   3.4.21  Serine endopeptidases
    3.4.21.-  
     DLE54_02825
Peptidases and inhibitors [BR:psyy01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   DLE54_02825
Peptidoglycan biosynthesis and degradation proteins [BR:psyy01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DLE54_02825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Regnase_1_C
Motif
Other DBs
NCBI-ProteinID: AWT48576
LinkDB All DBs
Position
complement(652638..654671)
Genome map
AA seq 677 aa AA seqDB search
MTVPRYNFCDLLPAKTLTKMATAIGLCLGISPLLYAQLPAPVEAALNRAHISTDDISLVI
MPVTATADNNTTTSTKTVKSRLPAVVPLNLVQKVKAEQPDLVDADELPPELESTASPSKI
AAQKLQTQPAQSNPAEKKTAPASSTASQNKSSAPAHNNPALTQGLIDTPAHESASDALAA
VNPSTVDDNQPLAYPLRHLSELPRTPASTMKLIPTFIALDLLGPNFVWVTQAYHTGFISA
NTLYGDLIIKGSGDPKLTLQRLNKLLEQVKQAGIQHIKGDIVLDSSVFQGVTKDPAAFDN
DPLRPYNASPDGLLVNFSTLELTAVPLLNDAQRGTAKLYYKPLMADYDLPTTLPTASLGN
CSSARSSLAPIWQAQGLKFNKSLPTSCGARTFYIAYPDAKDFAKRVVKGQWLSLGNTLSG
SIKFLGLGNTVAGDMINTETPLKTSAGTYLDMSSSTDKNAVLAQSVSVLPASPLPFVRYP
SLPLSQQIFDINHYSNNVMTEQLTLTLPLFSDPSAAPDTTGHAIKPQKDSYSNYTKALGT
INQWWQKNLTTPAPVMSNGSGLCRDCSVTAENLADLLQFAYNHRYFDTYVNSLGVAGISG
TITEHAERLPSSAAIGRAWIKTGTLNNVTSMAGYVHGKSGQDYIVVGIINGSTNQAPLNT
YEARYVLDTMLDWTAKH
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcctagatataacttctgtgacttattgcctgccaaaaccttaaccaagatg
gcaacggctatcggtttgtgcttagggattagccccttactgtatgctcagctacccgca
cctgtggaagcggcgcttaatcgtgctcacattagcaccgatgacatcagtttagtgatt
atgccggtaaccgctactgcagacaataacactaccaccagtaccaaaactgtaaaaagc
cgtctgccggcggtagtaccgcttaatctagtccagaaagtcaaggctgagcagccagat
ttggttgatgctgatgagctgccgcctgagcttgaaagcaccgcttcgccctcaaaaatt
gccgcccagaagctgcaaactcagcctgctcaatcaaaccctgccgagaaaaaaactgcg
ccagcctcaagtactgcatctcagaataaatcaagtgccccagctcataacaacccagcg
ctgactcagggcttaatcgatacccctgcccatgagtcagccagtgacgccctagctgct
gtcaatccaagcactgtcgacgacaatcagcccttagcctatccgctgcgtcatttatct
gaattaccgcgtacccctgccagcaccatgaagctgatccctacctttattgcgcttgat
ctgctcggccccaattttgtttgggtcactcaggcctatcacacaggattcatttcagcc
aatactttatatggtgatttaatcatcaaaggcagtggtgaccctaagctgacccttcag
cgtttaaataaactattagagcaggtaaaacaggccggtattcagcacatcaaaggcgac
attgtattagacagctccgtatttcaaggtgtgaccaaggatccggccgcttttgataat
gatccactgcgcccttataatgccagcccagatggcttattggttaacttcagcacccta
gagctcaccgctgtcccacttttaaatgatgctcagcgcggcactgccaagctatactat
aaaccgctaatggccgattatgatctgcccacaaccttacccacagcgagcctaggtaac
tgctcatcggcccgctcaagcttggcacccatatggcaagcacaaggcctaaaatttaat
aaaagcttgcctacctcttgcggtgctcgcactttttatatcgcctatcctgatgccaaa
gacttcgctaaacgagtggtcaaaggccagtggctaagtctgggcaataccttatcaggc
tctattaagtttttgggcctcggtaacaccgtagcgggcgatatgatcaataccgaaacg
ccgcttaagacaagcgctggcacttacttagacatgagcagcagcaccgataaaaacgcc
gtactggcacaatctgtctctgttctccccgcctcgccgctgccttttgtacgttatcct
tcgctgcctttatcgcagcaaattttcgatatcaatcactactccaataacgtcatgact
gagcagctaacgctgactttgccattattttcagaccctagcgctgcacctgataccaca
ggccacgctataaaaccacaaaaagacagctactctaactacaccaaggcactgggcacc
atcaaccaatggtggcaaaaaaatcttacgacccccgcccctgtcatgtctaacggctca
ggactgtgccgcgactgtagtgtgactgctgaaaatctagctgatctgctgcagttcgcc
tacaaccaccgctactttgacacttatgtcaattctttaggggtggccggcattagtggc
accattactgagcacgctgagcgtttacccagctcagcagccattggccgtgcttggatt
aaaacgggcaccttaaataacgtcacctccatggcaggctacgtacatggcaaatctggt
caggactatattgtggtcggtattatcaatggcagcaccaaccaagcacctttaaatacc
tacgaggcccgttatgtgcttgataccatgctagactggacagccaagcactaa

DBGET integrated database retrieval system