KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0303Help
Entry
PSTAB_0303        CDS       T01571                                 

Gene name
argE
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00220  Arginine biosynthesis
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01130  Biosynthesis of antibiotics
psz01210  2-Oxocarboxylic acid metabolism
psz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    PSTAB_0303 (argE)
Enzymes [BR:psz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     PSTAB_0303 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEJ03584
UniProt: F8H636
LinkDB All DBs
Position
341276..342427
Genome map
AA seq 383 aa AA seqDB search
MPIPSLKEQFAALIAAPSVSCTQPGWDQSNRPVIELLAAWLGELGFACETPEVAPGKFNL
LASYGSGPGGLVLAGHSDTVPFDGELWTADPLRLREADDRWYGLGSCDMKGFFALIIEAV
RPLLEQPFRRPLLILATCDEESSMSGARALAAAGQPLGRAALIGEPTGLRPVRLHKGIMM
ERIDILGQSGHSSNPAYGHSALEAMHGVIGEMMTLRRQWQAEYDNPLFDVPKPTLNFGCI
HGGDNPNRICGQCALEFDLRPLPGMDPQQLRGIIRQRLQPLAEQHQVKIDLAPLFPAVPP
FEQPAESELVRLAERLTGHRAEAVAFATEAPYLQQLGCETLVLGPGDIACAHQPDEYLQL
ERIEPTVQLLRRMIEHYCLQPQA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgcccattccttcgctcaaggagcagttcgccgcgctcattgccgcgccctccgtcagt
tgcacgcagcctggctgggatcagagcaaccgtccggtgatcgagctgctggccgcctgg
ctcggcgagttgggcttcgcctgcgagacgccggaggtcgcgcccggcaaattcaatctg
ctggccagctacggcagcggtcccggtggcctggtgctggccggacacagcgacaccgtg
ccgttcgatggtgaactgtggacggccgatccgctgcgccttcgcgaggccgatgaccgc
tggtacgggctcggcagttgcgacatgaagggcttctttgcgctgatcatcgaggcggtg
cggcctttgctggagcagccgttccgtcgtccgctgctgatcctcgccacctgcgacgaa
gaaagctcgatgtccggtgcccgcgccctggccgcagccggccagccgctcggccgcgcg
gcgctgatcggcgagcccacggggctgcggccggtgcgtctgcacaagggcatcatgatg
gagcgcatcgacatcctcgggcagagcggacattcttccaatcccgcctacggccacagc
gcgctggaagccatgcacggcgtgatcggcgagatgatgacgctgcgtcgacagtggcag
gccgagtacgacaatccgctgttcgacgtgcccaagccgaccctcaacttcggctgcatc
cacggcggcgacaaccccaaccgcatctgcgggcaatgcgcgctggagttcgacctgcgc
ccgctgccgggcatggacccgcagcagctgcgcgggatcattcgccagcgcctgcagccg
ctggccgagcagcaccaggtgaagatcgacctggcgccgctgtttccggcggtgccaccc
ttcgaacagccggccgaaagcgagctggtgcgcctggccgagcgcctcaccgggcaccgt
gccgaggcggtggcgtttgccaccgaagcgccttatcttcagcagctcggctgcgagacc
ctggtgctcggccccggcgacatcgcctgcgcgcaccagcccgacgagtacctgcagctc
gagcgcatcgaaccgaccgtgcagctgctgcgtcggatgattgagcactactgcctgcaa
ccccaggcctga

DBGET integrated database retrieval system