KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_0526Help
Entry
PSTAB_0526        CDS       T01571                                 

Definition
(GenBank) putative trehalose synthase protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00500  Starch and sucrose metabolism
psz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSTAB_0526
Enzymes [BR:psz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSTAB_0526
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PSTAB_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: AEJ03807
UniProt: F8H8H1
LinkDB All DBs
Position
complement(572697..574319)
Genome map
AA seq 540 aa AA seqDB search
MRPLWYRNAVIYQIDPSLFRDSNGDGCGDLRGITERLDYIRGLGCTAIWLMPFYQSPFED
AGYDISDHLQVAERFGDLADIVALLEKAEELGLHVIIELVVQHTSSEHRWFQEARRDRDS
PYRDYYIWADEPDDAIEPIFPTVEDSVWTWDEQAGQYYRHLFYKHEPDLNLTNPRVIHEI
ERIMSFWLRLGVSGFRIDAAVHMVRQAGGGDLRQGYWLLEHMRDFVTMRRPETVLLGEID
TDPEKYIEYFGDEADRVTLLLDFWVNNHLFLALARQQAEPLCRALNSQPLPPSHSQYALW
IRNHDELSLDRLEEDERNEVLDTFAPDQNMRAYNRGIRRRLAPMLDGDERRIAATHALLF
SLPGTPIIRYGEEIGMGDDLERPERLAVRTPMQWSNEPNAGFSCIDAQRLIAPVIDEGPF
AFDRVNVFAQTLRSDSLMARTGNMIRTRIGLREIGIGKRRTVEVDDPSVFAIRHDNDSTV
LMLVNLADRETTVTITDDDLQDMVDVLADCDYGQPEGTPLQLRLGPYGYRWLRRKQQLFG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccactctggtaccgcaacgcggtgatctatcagatcgacccctcgctgttccgt
gacagcaacggcgatggctgcggcgatctgcgcggcatcaccgagcgcctcgactacatt
cgcggcctcggttgcaccgcgatctggctcatgcccttctaccagtcgccattcgaggat
gccggctacgacatcagcgaccatctgcaggtggccgagcgcttcggcgacctggccgac
atcgtcgccctgctggagaaggccgaggagctgggtctgcacgtgatcatcgagctggtc
gtgcagcatacctccagcgaacaccgctggttccaggaagcgcgccgcgaccgcgactcg
ccctatcgcgactactacatctgggccgacgagccggacgacgccatcgagccgatcttt
cccacggtcgaagacagcgtctggacctgggacgagcaggccggccagtactatcgccat
ctgttctacaagcatgagccggacctgaacctgaccaacccgcgggtgatccacgagatc
gagcggatcatgtcgttctggctacgcctgggcgtgtcgggctttcgcatcgacgccgcg
gtgcacatggtgcgccaggccggcggtggcgacctgcgccagggttactggctgctggaa
cacatgcgcgacttcgtcaccatgcgccgcccggagaccgtattgctcggcgagatcgat
accgatccggagaagtacatcgagtacttcggtgacgaggccgaccgcgtcaccctgctg
ctggacttctgggtcaacaaccatctgttcctcgccctcgccaggcagcaggccgagccg
ctctgtcgcgcgctgaacagccagccgctgccacccagccattcgcaatacgccctgtgg
attcgcaaccacgacgagctgagcctcgaccggctggaggaggatgagcgcaacgaggtg
ctggatacctttgcccccgaccagaacatgcgcgcctacaaccgcggtattcgccgacgc
ctggcgcccatgctcgacggcgacgagcgacgcatcgccgccacccacgccctgctcttc
tccctgcccggcacgccgatcatccgctacggcgaggaaatcggcatgggcgacgatctc
gagcgcccggaacggctggcggtgcgcacgccgatgcagtggtccaacgagcccaacgcc
ggcttctcctgcatcgacgcgcaacggctgatcgccccggtgatcgatgaagggcccttc
gccttcgacagggtcaacgtattcgcccagaccctgcgcagcgactcactgatggcgcgc
accggcaacatgatccgcacccgcatcggcctgcgcgagatcggcatcggcaagcggcgc
acggtggaggtggacgacccgagcgtgttcgccattcgccacgacaacgattccacggtg
ctgatgctggtgaatctggcggaccgcgagaccaccgtgacgatcaccgacgacgacctg
caggacatggtcgatgtactcgccgactgcgactacgggcagcccgagggcaccccgctc
cagctgcggctgggtccgtacggctaccgctggctgcggcgcaagcagcaactgttcgga
tag

DBGET integrated database retrieval system