KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1199
Entry
PSTAB_1199        CDS       T01571                                 

Definition
(GenBank) hypothetical protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB
Motif
Pfam: Defensin_propep MoeA_C
Other DBs
NCBI-ProteinID: AEJ04480
UniProt: F8H1Y9
LinkDB
Position
1256429..1257148
AA seq 239 aa
MNLRPLLAAVVLFATFGASAQPAPVTNSRMVPAQVQPGADAALDERQAREWGLRSEEWAR
YRQLMQGPLGVYSPQLDPLTALGIEARSDEERRRYAELQVQAEAQRVGKTLAYQRAYDAA
WQRLFPGQPRVSLPGAKAQGAGNTGSGRLAVFVKADCAPCAQRVQQLQAAGTAFDLYMVG
SRQDDARIRQWATQAGIDPARVRARTITLNHDAGRWLSLGLPGDLPAVVREVNGQWQRQ
NT seq 720 nt   +upstreamnt  +downstreamnt
atgaacctgcggccgttgctcgctgccgtcgtcctgttcgccactttcggcgcatccgcc
caaccggccccggtgacgaactcgcgcatggtgcccgctcaagtgcagccgggcgctgat
gccgcgctcgacgagaggcaggcgcgggagtgggggcttcgctccgaggagtgggcgcgt
taccggcaactgatgcaggggccgctcggggtctattcgccccagctcgatccgctcacg
gcgctgggcatcgaggcccgcagcgacgaggagcgcaggcgctacgcggagttgcaggtg
caggccgaggcccagcgcgtcggcaagacgctggcctaccagcgcgcctacgacgcggcg
tggcagcgcctgtttcccggccagccgcgcgtgagcctgcccggcgccaaggcgcagggt
gccggcaacaccggctccgggcgcctggcggtcttcgtcaaggccgactgcgcaccgtgc
gcgcagcgcgtgcagcagttgcaggcggccggcacggccttcgatctctacatggtcggc
agccgtcaggacgacgcgcgcatccggcagtgggccacccaggcgggcatcgacccggcc
agggtgcgcgcccgcaccatcacgctcaaccacgatgcgggacgctggctgtcgctcggc
ctgcccggcgatctgccggccgtggtgcgcgaggtgaacggccaatggcagcggcaatag

DBGET integrated database retrieval system