KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1222
Entry
PSTAB_1222        CDS       T01571                                 

Definition
(GenBank) hypothetical protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: AEJ04503
UniProt: F8H212
LinkDB
Position
1284565..1285014
AA seq 149 aa
MPAHSLNLPAASRRPLATRLAAGLCAALLGPIAAAADVLIVTDSRHPVQAPAGVRIIELD
QATRIEVELAAHLPADPQQAAALVRQRLHDGGEALQRRIGHAYQGVADAWGLGIAKIPAV
VVDRRYVVYGEPDVPRAVARIKAYRSTQP
NT seq 450 nt   +upstreamnt  +downstreamnt
atgccggctcattccctcaaccttcctgccgcttcgcggcgccccctggccacgaggctg
gccgctggactgtgcgccgcgctgctcggtcccatcgcggcggccgccgatgtgctcatc
gtcaccgacagccgtcatccggtgcaggccccggccggcgtgcggatcatcgagctggac
caggccacgcgcatcgaggtcgaactcgccgcgcacctgccggccgacccgcaacaggcc
gcggccctggtgcggcagcggttgcatgacggcggcgaggcgctccaacgccgcatcggc
catgcctaccaaggtgtcgcggatgcctggggactgggcatcgccaagattcccgccgtg
gtggtcgatcgacgctacgtggtctacggcgagcccgacgtgccccgcgccgtcgcgcgc
atcaaggcctaccggagcacgcagccatga

DBGET integrated database retrieval system