KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2041Help
Entry
PSTAB_2041        CDS       T01571                                 

Definition
(GenBank) alpha-amylase family protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00500  Starch and sucrose metabolism
psz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSTAB_2041
Enzymes [BR:psz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSTAB_2041
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PSTAB_2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AEJ05322
UniProt: F8HAS2
LinkDB All DBs
Position
complement(2169869..2173195)
Genome map
AA seq 1108 aa AA seqDB search
MAKPRKPAAFIKDPLWYKDAVVYQVHLKSFYDSNNDGVGDFVGLIEKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIADYRGVHPEYGNMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKKGSAARNFYVWSDTDDKYQGTRIIFLDTEKSNWTWDPVAKQYFWHRFYSHQ
PDLNFDNPQVMKAVLAVMRFWLDMGIDGLRLDAIPYLVERDGTNNENLPETHAVLKAIRA
EIDANYPDRMLLAEANQWPEDTQLYFGGEDGGPGDECHMAFHFPLMPRMYMAIAQEDRFP
ITDILRQTPDIPDNCQWAIFLRNHDELTLEMVTDRERDYLWNYYASDKRARINLGIRRRL
APLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMGDNIFLGDRDGVRTPMQWSVDRNGG
FSRADPPNLVLPPVMDPLYGYYTINVEAQQRDPHSLLNWTRRMLTIRKQFKAFGRGTLKM
LAPSNRRILAYLREFTGADGQTEIIFCVANVSRSAQAAELEMSQYAGMVPVEMVGGSAFP
PIGQLPYLLTLPPYGFYWFQLAPTNQMPSWHQEPVETMPDFQTLVLKRLDTLTAANRRTL
EAESLPAYLPKRRWFAAKDVAIDSIRISYCIPFGDPNRPVLLSELCVESAGRSDLYQLPL
GFLDESDFGTALPQQLALARVRRGPQVGLMTDAFALEQFSAAVIQGLRDELVLPCSDGEI
RFVPMPQLDDLQLPEQPEVRFISAEQSNSSAIIDNKVMIKLLRRVAAGIHPELEMGGFLT
ARGFAHISGMLGQVSRINKQGEPVALMVIQHFLDSQGDAWVWTLNNLDRAVRDEIAGGVS
MHENQFSALDELQAFNRLLGQRLGEMHMALAADTDDAAFAYEITSAANVEQWAQSISAQL
EQALQRIDEHRSTLERRDAAAVGQLLQRRDQLLAQVKRLAARTVGGVRTRVHGDLHLGQV
LVVQGDAYFIDFEGEPARSLDERRAKHSPFKDVSGLLRSFEYAAAMTIRGAQVSDSTPEA
DQARQRIAASYQRSAQQAFLDAYRDATRELPHAWQEQDGANAALLLFSLEKCAYEIVYEA
ENRPTWLPVPLQGLMALAQQLFDGDSND
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccgcgcaaaccggccgcattcatcaaggatccgctctggtacaaggacgcg
gtggtgtaccaggtgcacctgaaatccttctacgactccaacaatgacggcgttggtgac
ttcgtcgggctgatcgagaagctggattacatcgccgacctgggcgtgaacaccatctgg
ctgctgccgttctatccctcgccgcggcgcgacgatggctacgacatcgccgattaccgc
ggcgtgcatcccgagtacggcaacatggccgatgcccggcgcttcattgccgaagcgcac
aagcgcgggctgcgggtgatcaccgagctagtcatcaaccacacctcggaccagcatccc
tggttccagcgggcgcgcaaggcgaagaagggctcggcggcgcgcaatttctacgtctgg
tccgacaccgacgacaaataccagggcacgcggatcatctttctcgacaccgagaaatcc
aactggacctgggacccggtggccaagcagtacttctggcaccgcttctattcccaccag
ccggatctgaatttcgacaacccgcaggtgatgaaggcggtactggccgtcatgcgcttc
tggctggacatgggcatcgacggcctgcggctggacgcgattccctacctggtcgagcgt
gacggcaccaacaacgaaaacctgcccgagacccacgcggtgctcaaggccatccgcgcc
gagatcgacgccaactatcccgatcgcatgttgctggccgaggccaaccagtggccggag
gatacccagctgtacttcggtggcgaagacggcggccctggcgacgaatgccacatggcg
ttccacttcccgctgatgccgcgcatgtacatggccatcgcccaggaagaccgctttccg
atcaccgacatcctgcggcagacgccggacatcccggacaactgtcagtgggcgatcttc
ctgcgcaaccacgatgagctgaccctggagatggtcaccgatcgcgagcgtgactatctg
tggaactactacgcctcggacaagcgggcacgcatcaacctcggcatccgtcggcgtctg
gcaccgctgctggagcgcgaccgtcgccgtatcgaactgctcaacagcctgctgctctcc
atgccgggcacgccggtgatctactacggtgacgagatcggcatgggcgacaacatcttc
ctcggcgatcgcgacggtgtgcgcacccccatgcagtggtcagtggaccgcaacggcggt
ttctcccgcgccgacccgccgaacctggtgctgccgccggtgatggacccgctctacggc
tactacaccatcaacgtggaggcgcagcagcgcgacccgcattcgctgctgaactggaca
cggcggatgctcaccatccgcaagcagttcaaggccttcggccgcggcacgctgaagatg
ctggcgccgagcaaccggcgcatcctggcctatctgcgcgaattcaccggggcggatggc
cagaccgagatcatcttctgcgtggccaatgtctcgcgttcggcccaggcggcggaactg
gaaatgtcgcagtacgccggcatggtcccggtggagatggtcggcggcagcgcctttcca
cccatcggccagctgccctacctgctgacactgccgccctacgggttctactggttccag
ctggcgcccaccaaccagatgcccagctggcatcaggagccggtggagaccatgccggac
ttccagaccctggtactcaagcgcctcgacaccctgaccgccgccaatcgacgcacgctg
gaagccgagtctctgccggcctatctgccgaagcggcgctggttcgcggccaaggatgtg
gcaatcgactcgatccgcatcagctactgcataccgttcggcgacccgaaccggccggtg
ctgctcagcgaactctgcgtggagtcggccgggcgcagcgacctctaccagttgccgctg
ggcttcctcgacgagtctgatttcggcaccgcgctgccccagcagctggcattggccaga
gtacgccgcggcccgcaggtggggttgatgaccgatgccttcgccctcgagcagttcagc
gccgctgtgatccagggactgcgcgacgagctggtgttgccgtgcagcgacggtgaaatc
cgcttcgtgccgatgccgcaactggacgatctgcagttgccggagcagcccgaggtacgc
ttcatttcggcagagcagtccaacagttcggcgatcattgacaacaaggtgatgatcaag
ctgctccgtcgcgtggcagcggggattcaccctgaactggaaatgggcgggttcctcacc
gcgcgcggtttcgcccatatttccggcatgctcgggcaggtcagccggatcaacaagcag
ggcgagccggtggcgctgatggtgatccagcacttcctcgacagccagggtgacgcctgg
gtctggacgctgaacaacctcgaccgcgccgtacgcgacgaaatcgccggcggtgtatcg
atgcacgagaaccagttcagtgccctcgacgagttgcaggccttcaaccggctgctcggg
cagcgtctgggcgagatgcacatggccctggcagcggacaccgacgatgccgcatttgcc
tacgaaatcaccagcgcggcgaacgtcgagcagtgggcgcagagcatcagcgcccagctt
gagcaggcactgcagcggatcgacgaacaccgttccactctcgagcgcagggatgccgcc
gcggtggggcagctgctccagcgccgcgatcagctgctcgcacaagtgaaacgtctggcc
gctagaacggtggggggcgtgcgcacccgcgtgcatggcgacctgcacctcgggcaggtt
ctggtggtgcagggcgatgcgtatttcatcgacttcgagggcgagccggcccgttcgctg
gatgaacgacgggcgaaacacagcccgttcaaggatgtctcaggcttgctgcgctcgttc
gaatacgccgcggccatgaccattcgtggtgcacaggtcagcgacagcacgccggaggcc
gatcaggctcgccagcgcattgccgcgagctaccagcgcagcgcacaacaagccttcctc
gatgcgtaccgcgatgccacccgggagctgccacatgcctggcaggagcaggatggcgcg
aatgctgcactgctgctgttcagcctggagaaatgcgcgtacgagatcgtttacgaagcg
gagaaccgtccgacctggttgcccgtcccgctacaggggctgatggccctggcacaacag
cttttcgatggagattccaatgactga

DBGET integrated database retrieval system