KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2147Help
Entry
PSTAB_2147        CDS       T01571                                 

Gene name
fabI
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00061  Fatty acid biosynthesis
psz00780  Biotin metabolism
psz01100  Metabolic pathways
psz01130  Biosynthesis of antibiotics
psz01212  Fatty acid metabolism
Module
psz_M00083  Fatty acid biosynthesis, elongation
psz_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSTAB_2147 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PSTAB_2147 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PSTAB_2147 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psz01004]
    PSTAB_2147 (fabI)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PSTAB_2147 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PSTAB_2147 (fabI)
Lipid biosynthesis proteins [BR:psz01004]
 Fatty acid synthase
  Component type
   PSTAB_2147 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF2102
Motif
Other DBs
NCBI-ProteinID: AEJ05428
UniProt: A0A4P1S9G1
LinkDB All DBs
Position
2298963..2299757
Genome map
AA seq 264 aa AA seqDB search
MGFLTGKRVLIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLKGRVEEFAAGWGSSPE
LCFPCDVANDEDIARVFEELGKKWDGLDCIVHSVGFAPGDQLNGDFTEVTTREGFKIAHD
ISAYSFVALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSL
GPEGTRVNCISAGPIRTLAASGIASFRKMLAANEKQTPLRRNVTIEEVGNAGAFLCSDLA
SGISGEILYVDGGFNTTAMGSLED
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcaccggtaagcgcgtactgatcgtcggcgttgccagcaaactgtcgatt
gcctcgggcatcgccgccgccatgcatcgcgaaggtgcagaactggctttcacctaccag
aacgacaagctcaagggccgcgtcgaggaattcgccgccggctggggctcgagcccggag
ctgtgcttcccctgcgacgtcgccaatgacgaagacatcgcccgcgtgttcgaggagctg
ggcaagaagtgggacggcctggactgcatcgttcactcggtcggcttcgccccgggcgac
cagctgaacggcgacttcaccgaagtcaccacccgcgaaggcttcaagatcgcccacgac
atcagtgcctacagcttcgtcgccctggccaaggccggtcgcgagatgatgaagggccgc
aacggcagcctgctcacgctctcctacctgggcgccgagcgcaccatgccgaactacaac
gtgatgggcatggccaaggccagcctggaagccggtgtacgctacctggctggcagcctt
ggcccggaaggcacccgcgtcaactgcatctccgccggcccgatccgcaccttggcagcc
tccggcatcgccagcttccgcaagatgctcgccgccaacgagaagcagaccccgctgcgc
cgcaacgtcaccatcgaggaagtcggcaacgccggtgccttcctctgctcggacctggcg
tccggcatcagcggtgagatcctttacgtcgacggcggcttcaacaccaccgcgatgggc
tcgctggaagactga

DBGET integrated database retrieval system