KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2187Help
Entry
PSTAB_2187        CDS       T01571                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00020  Citrate cycle (TCA cycle)
psz00480  Glutathione metabolism
psz01100  Metabolic pathways
psz01110  Biosynthesis of secondary metabolites
psz01120  Microbial metabolism in diverse environments
psz01130  Biosynthesis of antibiotics
psz01200  Carbon metabolism
psz01210  2-Oxocarboxylic acid metabolism
psz01230  Biosynthesis of amino acids
Module
psz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTAB_2187 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSTAB_2187 (icd)
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PSTAB_2187 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH HTH_15
Motif
Other DBs
NCBI-ProteinID: AEJ05468
UniProt: F8H016
LinkDB All DBs
Position
2343104..2345332
Genome map
AA seq 742 aa AA seqDB search
MSTPSKIIYTFTDEAPALATYSLLPIVEAFAASADISVETRDISLAGRILASFADQLDAD
KKVEDDLAKLAELTNQPDANIIKLPNISASVPQLKAAIAELQALGYNIPNYPEDPQTDAE
KDARARYSKVLGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSKASQSHADYMRGG
DFFSSEQSITMEKAGDVRIEFVGKDGKVEVKKQLALQEGEVLDGMFMSCKKLRAFFEDTL
QDCKETGIMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKYGDLFKELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPVTMGSVPNVGLMAQKAEEY
GSHDKTFEMHADGTMRVVLADGTVLMQHEVEKGDIWRACQTKDAPIRDWVKLAVTRARQS
NTPAVFWLDPERAHDMQLQKKVETYLQEHDLSGLDIRIMGYNEAIRLSMERMIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNGKAKILGKTLDQATGKLLDNNKSPARKVGQIDNRGSH
FYLALYWAQALAAQDEDAELKAHFTPLAKTLTEQEAAIVAELAAVQGKPVDIGGYYRSNP
ELTSKVMRPSATFNAALAALNA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccttcgaagatcatctataccttcaccgacgaagctccagccctggcaacc
tattcgcttcttcccattgtagaagccttcgcagcctccgctgacatctccgtcgaaaca
cgcgacatctctcttgcagggcgcatccttgcgagcttcgccgatcagctggatgccgac
aagaaagtcgaagatgatctggccaagcttgccgagctgaccaaccagcccgacgccaac
atcatcaagctccccaacatcagcgcctccgttccacagctcaaggcagcgatcgccgag
ctgcaggccctgggctacaacatccccaactaccccgaagacccgcagaccgatgccgag
aaagacgcgcgcgcgcgttacagcaaggtgctcggtagcgccgtgaacccggtgctgcgc
gaaggcaactccgaccgccgcgctccggccgccgtgaaagcctatgcccgcaagcacccg
cattcgatgggcaagtggagcaaggcgtcgcaatcgcacgccgactacatgcgcggcggc
gacttcttctccagcgagcagtcgatcaccatggaaaaagccggtgacgtgcgtatcgag
ttcgtcggcaaggacggcaaggtagaggtcaagaagcagcttgccctgcaggaaggcgaa
gtgctcgatggcatgttcatgagctgcaagaagctgcgcgcgttcttcgaagacacgctg
caggactgcaaggaaaccggcatcatgtggtccctgcacgtcaaggcgaccatgatgaag
atctcccacccgatcgtcttcggccatgccgtgagcgtttactacaaggacgtcttcgac
aagtacggcgatctgttcaaggagctgggcgtcaacccgaacaacggcatcagcagcgtc
tacgacaagatcaagtccctgcccgcttcgcagcaggaagaaatcctgcacgacatccat
gaggtctacagccaccgtccggaaatggcgatggtcgactcggtcaaaggcatcaccaac
ctgcacatcccgagcgacgtgatcgtcgacgcctcgatgccggcgatgattcgcaactcc
ggccagatgtggggcaaggatggcaagcagaaggacaccaaggcggtgatgccggagagc
acctacgcccgcatctaccaggaaatgatcaacttctgcaaaaccaacggcgccttcgac
ccggtcaccatgggcagcgtgccgaacgtcggtctgatggcgcagaaggctgaggaatac
ggctcgcacgacaagaccttcgaaatgcacgccgacggcaccatgcgcgtcgtactggcc
gatggcaccgtactgatgcagcacgaagtcgagaaaggcgatatctggcgtgcctgccag
accaaggacgcgccgatccgcgactgggtcaagctggccgttacccgcgcccgccagtcc
aacaccccagccgtgttctggctggacccggagcgtgcccacgacatgcagctgcagaag
aaggtcgaaacctatctgcaggagcacgacctgagcggcctggacattcgcatcatgggc
tacaacgaagccattcgcctgagcatggagcgcatgatccgcggcaaggacaccatttcc
gtcaccggcaacgtgctgcgcgattacctgaccgacctgttcccgatcatggagctgggc
acctcggccaagatgctgtccatcgttccactgatggccggcggcggcatgtacgagact
ggcgccggtggttccgcgccgaagcacgtgcagcagctggtcgaagaaaactatctgcgc
tgggattcgctgggtgagttcctcgccctggcggtttcgctggaggagactggcatcaag
actggcaacggcaaggcgaagatcctcggcaagaccctggaccaggccactggcaagttg
ctggacaacaacaagtccccggcgcgcaaggttggccagatcgacaaccgcggcagccac
ttctacctggcactgtactgggcgcaggctctggccgcgcaggacgaagatgccgagctg
aaggctcacttcactccgctggccaagaccctgaccgagcaggaagcggccatcgtcgct
gaactggcagccgtgcaaggcaagccggtcgacatcggcggctactaccgctccaacccg
gagctgaccagcaaggtgatgcgccccagcgccaccttcaacgctgccctggccgcgctg
aacgcctga

DBGET integrated database retrieval system