KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2474
Entry
PSTAB_2474        CDS       T01571                                 

Definition
(GenBank) Putative uncharacterized protein ORF SG71
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB
Motif
Pfam: Glutaredoxin DUF836
Other DBs
NCBI-ProteinID: AEJ05755
UniProt: F8H283
LinkDB
Position
2670569..2671294
AA seq 241 aa
MKPRHIVPALIVLLTGGLAQGAENLVADNLPSREQPTATERADEQYARDWNLGAEEWARY
RALMQGPLGIYSPNLDPLTALGIEARSNQERQRYAELQVETEALRVEKLLAYQRAYDDAW
QRLHADIPRVILPDAGPEFSPITPATSGRIAVFVKDACPVCDQSTLRLQAAGMAFDIYVV
DSRADDARIRAWAQRIGIDPAKTRSGQITLNHDSGRWQSLNLQGDLPAVVRQVGNQWQRQ
P
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaagccgcgccatatcgtccccgcacttatcgtcctactgaccggcgggctcgcccag
ggcgcggaaaacctcgtcgccgacaaccttcccagccgcgagcagccgacggccaccgaa
cgcgccgacgagcagtacgcacgggactggaacctgggtgccgaggaatgggcgcgctac
cgggcgctcatgcaagggccgctgggtatctattcgcccaaccttgatccgcttaccgca
ctgggcatcgaagcacgctccaaccaggaacggcagcgttacgcggagttgcaggtcgag
accgaagccctccgcgtcgaaaagctgctcgcttaccaacgggcttacgacgacgcctgg
cagcggctccacgccgatataccgcgcgttatcctgcccgatgccggcccggaattctcg
ccgatcacgcccgcaacgagtggacgaatcgccgtgttcgtcaaggacgcctgcccagtc
tgcgatcaatccacgctgcggctgcaggcagccggtatggcgttcgacatttacgtcgtc
gacagccgcgccgacgacgcacgcatccgcgcctgggcacagcgcatcggcatcgacccg
gccaagacgcgcagcggccagatcacgctcaaccacgattcgggacgctggcaatcgctg
aacttgcagggcgacctgccggcagttgtacgccaggtcggaaaccagtggcagcggcag
ccgtaa

DBGET integrated database retrieval system