KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_2513Help
Entry
PSTAB_2513        CDS       T01571                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSTAB_2513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psz02000]
    PSTAB_2513
Enzymes [BR:psz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PSTAB_2513
Transporters [BR:psz02000]
 Other Transporters
  Pores ion channels [TC:1]
   PSTAB_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AEJ05794
UniProt: F8H2V6
LinkDB All DBs
Position
2715143..2715823
Genome map
AA seq 226 aa AA seqDB search
MMSVTLYGVPLSPFVRKVRLCLQEKGLDYQLETVMPFTPPDWYYAINPLGRIPALKDGDC
TLADSSVICQYLEEAYPATPTLYGDSAQARGQVRWLEKYADYELAPLTTFTVFRNRILKP
TSGQPCNEEAVQTAMQQKLPPHFDYLEQQLGDNDFFVCARLSMADIAVTCQLINMSHGGE
QLDAQRWPGLAAHHARMLARPAIESLLPGEQRMNAKLQEMGKAATV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgtgaccctgtacggcgtgcccctctcccccttcgtccgcaaggtacggctg
tgcctgcaggaaaagggactcgactatcagcttgaaacggtgatgcccttcaccccgcca
gactggtactacgccatcaacccgctgggacgtattcccgcgctcaaggatggtgactgc
accctcgccgactccagcgtgatctgccagtacctcgaagaagcctatcccgccacgcca
accctgtacggcgacagcgcccaagcgcgcggccaggtgcgctggctcgagaaatacgcg
gattacgagctggcgccgttgaccaccttcaccgtgtttcgcaaccgaattctcaagccg
acctccggccagccgtgcaacgaagaggcggtgcagacagcgatgcagcagaagctgccg
cctcatttcgactacctcgagcagcagctcggcgacaacgatttcttcgtctgcgcccgg
ttatccatggcggacatcgccgtgacctgtcagctgatcaacatgagccacggcggcgaa
cagctcgatgcccagcgctggccggggctggctgcacaccatgcgcgcatgctggcgcgt
cccgccatcgaaagcctgctgccgggcgagcaacgcatgaatgccaagctgcaggagatg
ggcaaggccgctaccgtctag

DBGET integrated database retrieval system