KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4061Help
Entry
PSTAB_4061        CDS       T01571                                 

Gene name
nasE
Definition
(GenBank) nitrate ABC transporter permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
psz00910  Nitrogen metabolism
psz02010  ABC transporters
Module
psz_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:psz00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PSTAB_4061 (nasE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PSTAB_4061 (nasE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psz02000]
    PSTAB_4061 (nasE)
Transporters [BR:psz02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    PSTAB_4061 (nasE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEJ07342
UniProt: F8H5Y6
LinkDB All DBs
Position
4386086..4386955
Genome map
AA seq 289 aa AA seqDB search
MNANVKLQPASTEPVSIVRPSRAAALMQRSGRYAVQQLLPPLVILLVLGVIWEMLCSGAD
AALPPPSQVIAETWELIVDPFYDNGGNDVGLAWQLLASLERVAVGYLLAVVAGVGLGVLI
GQSDWAMRGLDPIFQVLRTVPPLAWLPLSLAGFQDSHPSALFVIFITAIWPIIINTAVGI
RNIPQDYRNVAQVLQLNGFEYFKTIMLPAAAPYIFTGLRIGVGLSWLAIIAAEMLIGGVG
IGFFIWDAWNASRISDIILALVYIGVVGFVLDRLVAFVGQRITRGIPAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaacgtcaaactgcagcccgccagcaccgagccggtgtccattgtccgccca
tccagagccgctgccctgatgcagcgtagcggccgctacgcggtgcagcagctgttgccg
ccactggtcatcctgctggtgctcggggtgatctgggagatgctctgctccggtgccgat
gccgcgctgccaccgccttcgcaggtgatcgcggaaacctgggaactgatcgtcgatccg
ttctacgacaacggcggcaatgacgtgggcctggcctggcaactgctggccagcctcgaa
cgggtagcggtcggctatctgctggcggtagtcgccggggtcggcctcggcgtgctgatc
ggccagtcggactgggccatgcgcggcctcgatccgatcttccaggtgctgcgcaccgtg
ccgccactggcctggctgccgctgtcgctggcgggctttcaggacagccatccctcggcg
ctgttcgtcatcttcatcaccgcgatctggccgatcatcatcaataccgcggtgggcatc
cgcaacatcccgcaggactaccgcaacgtcgcccaggtgctgcagctcaatggcttcgaa
tacttcaagaccatcatgctgccggccgccgcgccctacatcttcaccggcctacgcatc
ggcgtcggcctgtcgtggctggcgatcatcgccgcggagatgctcatcggcggcgtcggc
atcggcttcttcatctgggatgcgtggaacgcctcgcgcatcagcgacatcatcctcgcg
ctcgtctacatcggcgtggtcggcttcgtactcgatcgcctggtggccttcgtcggccag
cgcatcacccgcggcattccggccaactga

DBGET integrated database retrieval system