KEGG   Paenibacillus terrae: HPL003_00130Help
Entry
HPL003_00130      CDS       T01668                                 

Gene name
valS
Definition
(GenBank) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
pta  Paenibacillus terrae
Pathway
pta00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPL003_00130 (valS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pta01007]
    HPL003_00130 (valS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_00130 (valS)
Enzymes [BR:pta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     HPL003_00130 (valS)
Amino acid related enzymes [BR:pta01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HPL003_00130 (valS)
Transfer RNA biogenesis [BR:pta03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HPL003_00130 (valS)
 Prokaryotic type
    HPL003_00130 (valS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1f CCDC-167 tRNA-synt_1b ABC_tran_CTD DUF2312 YlqD
Motif
Other DBs
NCBI-ProteinID: AET56812
UniProt: G7VT22
LinkDB All DBs
Position
complement(29532..32171)
Genome map
AA seq 879 aa AA seqDB search
MEMPTTYDPKSAEKKWYKTWMEKGYFRAGRLPEAEPFTIVIPPPNVTGMLHIGHALDFTL
QDIIIRTKRMQGYDALWLPGADHAGIATQTKVEQKLREEGLTRYDLGREKFLEKVWEWKD
LYLDNIHNQWEKMGFSLDYSRERFTLDEGLSQAVREVFVKLYKKGLIYRGKRIINWDPAA
RTALSDIEVEYKEVNGNLYHLQYPLQDGSGFITVATTRPETMLGDTAVAVHPEDERYKHM
IGKTLVLPIIGREIPIIADDYVDKDFGSGAVKITPAHDPNDFEMGQRHQLPQITVMDETG
TMNAEAGKYQGLDRSDCRKQIVADLKEQGVLIRIEEHVHQVGHSERTGVVVEPYLSTQWF
VEMKPLAAKAIEVQKAGNGVNFVPDRFERTYLHWIENVRDWCISRQLWWGHRIPAWYDEE
TGEIIVSMEDPTTLPEYAGRKLKQDEDVLDTWFSSALWPFSTLGWPEQTEDLKRYYPTNV
LVTGYDIIYFWVSRMIFTALEFTEEIPFKDVLMHGLVRDAEGRKMSKSLGNGVDPLDVID
QYGTDAMRYMISTSSTPGQDLRFRWERVEQARNFANKIWNASRFALMNLEGVTAADIDIT
GDLGTADRWILHRLNETSRDITRLIDAYEFGETGRLLYNFIWDDLCDWYIEFAKLALYGE
NAEAKKKTQSVLAYVLDRTLRMIHPFMPFISEEIWQHLPHEGETITLAAWPVYDSAFEDK
DAVAEMNLLIDVIRAVRNIRSEVNVPMSKKIELLVKPGDQAVLDIINRNGDYVRRFCNTS
EFDTGLELSVPDKAMTSVVSGAELYLPLAGLLDIAQEISRLEKELQHLNSEVERVEKKLS
NQGFVAKAPAKVIEEEKAKQADYSDKRAKVITRIEELKG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatgccgacaacgtacgatccaaaatcagccgagaaaaaatggtacaaaacgtgg
atggagaaggggtatttccgcgctgggcgacttccagaggcagagccttttacaatcgtt
attccacccccgaatgtgacgggtatgctgcacattggacatgctcttgattttactttg
caggacattattatccgcaccaagcggatgcagggctatgacgcattgtggctgccaggg
gcagaccatgcgggcattgccacccagacgaaggtggagcagaagctgcgtgaggaaggc
ttgacgcgctacgatctgggacgcgagaaatttttggagaaggtttgggaatggaaggat
ctctacctggacaacattcataatcaatgggaaaaaatgggattttctcttgactattcg
cgtgagcgttttacgctggatgaggggttgtctcaagccgttcgcgaagtatttgtcaag
ctgtacaagaagggcctgatttatcgcggtaaacgcatcattaactgggaccctgctgca
cgtaccgctctatcagatattgaagtggaatacaaagaggtaaacggaaatctgtatcac
ctgcaatatccgcttcaagatggcagtgggtttatcactgtagccaccacgcgtcctgaa
accatgctgggcgatacagcggtagccgtacatccggaggatgaacggtacaagcatatg
atcggtaaaacactcgtacttccgattatcgggcgggaaattccgatcattgcggacgac
tatgtagataaagatttcggtagcggcgcggttaaaattacaccagctcatgatccgaat
gactttgaaatgggacaacgtcaccagttgccacaaattacggtaatggacgaaacagga
acgatgaatgccgaagcaggcaaatatcagggtcttgatcgcagcgattgccgtaagcag
atcgtcgctgatctgaaagagcagggcgtactcatccgtattgaagagcatgtgcaccag
gtaggccacagcgagcgtacaggtgtggttgtagaaccttatctgtctacacaatggttc
gtggaaatgaagcctctggcagccaaagcgattgaagtgcagaaggctggcaatggcgtc
aactttgttccggaccgctttgagcgtacttatctgcactggattgaaaatgtgcgtgac
tggtgtatttcccgccaattgtggtggggacatcgtattccggcttggtacgatgaagaa
accggtgagattattgtatcgatggaggaccctacaaccttgcctgaatatgctggcaga
aagctgaaacaggatgaggacgtgctggatacatggttcagctctgccctgtggccgttt
tcgacactgggctggcctgagcagactgaggatctcaaacgctactacccgaccaatgtc
ttggttacaggctatgacattatttatttctgggtatcgcgaatgatctttaccgcactg
gagtttacggaagagattccgttcaaggacgtgcttatgcacggtttggtgcgtgatgcg
gaaggtagaaaaatgtccaaatccctcggcaatggtgttgatccgctcgacgtaatcgac
caatatggcacggatgccatgcggtatatgatttctaccagcagcacgcctgggcaggac
cttcgcttccgttgggaacgggtagagcaggcacgtaactttgccaataaaatctggaat
gcgtcgcgctttgcgctgatgaatctggaaggggtaactgcggcggatatcgacattacc
ggtgatttgggcacagctgaccgctggatccttcaccgtttgaacgaaacttcacgcgat
atcacgcgtctaatagatgcttatgaatttggcgagacaggccgccttctgtacaacttt
atttgggatgacctgtgcgactggtacatcgagtttgcaaagctcgccctgtatggcgag
aacgcagaggcgaaaaagaaaacacagtccgtactggcgtatgtgctggatcggacactg
cgcatgattcatccgttcatgccgtttatctccgaagaaatatggcagcatcttccgcat
gaaggcgaaacgattacactggccgcatggcccgtttatgattcggctttcgaggacaag
gatgcggtagctgaaatgaatttgctgattgatgtgattcgtgcagtgcggaatatccgt
tctgaagtgaacgtgccgatgagtaaaaagatcgaattgctcgtaaaacccggcgatcaa
gccgttctcgatatcattaaccgcaatggggattatgtgcgtcgattctgtaatacgtct
gaattcgacacgggattggagctctctgttccagataaagccatgacttctgtagtcagc
ggagcagagctatacctgccgttagccgggctgcttgatattgcccaggaaattagcaga
ctggaaaaagagcttcagcatttgaacagtgaagtggagcgcgtggagaaaaagctgtcc
aaccaaggcttcgtggcgaaggcaccagccaaagtcatcgaggaagagaaggccaagcaa
gccgattattcggataagcgcgccaaagttatcacacggattgaagaactcaagggataa

DBGET integrated database retrieval system