KEGG   Paenibacillus terrae: HPL003_03675Help
Entry
HPL003_03675      CDS       T01668                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pta  Paenibacillus terrae
Pathway
pta00620  Pyruvate metabolism
pta00680  Methane metabolism
pta01100  Metabolic pathways
pta01120  Microbial metabolism in diverse environments
pta01200  Carbon metabolism
Module
pta_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPL003_03675
  09102 Energy metabolism
   00680 Methane metabolism
    HPL003_03675
Enzymes [BR:pta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     HPL003_03675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace
Motif
Other DBs
NCBI-ProteinID: AET57509
UniProt: G7VT94
LinkDB All DBs
Position
complement(749745..752537)
Genome map
AA seq 930 aa AA seqDB search
MTELTLTANKNQSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRAGYQP
ELYENFKQIVSGLDTDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYEHSAGEDIQRGSI
ESSVQELKQGGFSAEDVSSLLEELSLELVMTAHPTEATRRVILDIHKRISEDVMLLDNPM
LTLREREQVRENLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHVLPDVYQELE
RCLGKYYPEQRWHIPTYLRFGSWIGGDRDGNPSVTAHVTWETLRMQRKLALREYQHTLKE
FMGYLSFSTSIIRVSDDLLASIEEDRTHITLKKMEVWHNEKEPYRIKLAYMIAKVNNILD
ESKQGTKERYSCAEELIADLNVIDDSLRHHFADYVADTYIQKMIRQVELFGFHTATLDVR
QHSQEHENAMTEILSKMNIVADYGKLPEEEKIDLLEKLLNEPRPITSPYLKYSDSTQECL
DVYRTIYLAQEEFGKQSITSYLISMTQGASDLLEVMVLSKEVGLFRIEKDGTVVCTLQSV
PLFETIDDLHAAPSIMKRLLNLPVYRQSVAAMDQLQEIMLGYSDSNKDGGVVTANWELRV
AMNSITEVVNEFGVKVKFFHGRGGALGRGGMPLNRSILAQPPHTIGGGIKITEQGEVLSS
RYSLKGIAYRSLEQATSALITAVAYNRSGKKEVFEESWEEIIAHISEVSLEKYQDLIFRD
PDFFAFFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYQNNEDNLKVLQTMFKESAFFRSLIDTLQMAIAKADLLIAEEYAGMSDNEEARQ
RIFGQISEEFKLTSELILKITGQSEILDDVPVIQESIRLRNPYVDPLSYLQVQLLSELRE
LRNQNGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcttacgttaaccgctaacaaaaaccaatccaacaatctgctgcggcgggac
gttcgttttctggggaatattcttggtgaggttttggttcatcagggtggcaacgaactt
ttggatatcgtggaaaagatacgtgagacaagtaaatcgttacgtgccgggtatcagccg
gagttgtatgagaatttcaaacaaatcgttagcggactggatacggacattcgtcaccag
gttattcgcgcgtttgcgatttattttcagttagtgaatattgccgagcaaaatcatcgt
atccgccgcaaacgggactatgagcattctgctggtgaagatattcaacgtggttcaatt
gaaagttctgttcaggagcttaagcagggtggattttctgctgaggacgttagcagtctg
ctggaggagctttctctggagctggttatgactgcacatcctacagaggccacgagacgg
gtgattttggacattcacaagcgcatttccgaggacgtcatgctgttggataatcctatg
cttaccttgcgggagcgggaacaggtgcgggaaaatctgctgaatgaagtgattacacta
tggcagacagacgaactgcgtgatcgcaaaccgactgtgttagacgaagtaagaaatggg
atgtattattttcatgagactttgtttcatgtgctgccggatgtataccaagaattggaa
cgatgtttaggcaaatattatcctgagcagagatggcacattccgacctatttgagattt
ggctcctggatcggtggggaccgggacggtaacccgtctgttacggctcatgttacttgg
gaaacgttacgtatgcagcgtaagctggctttgagagaatatcagcacacgctgaaggaa
tttatgggttatctgagctttagcactagcattatacgtgtctctgatgatttgctggct
tctattgaggaagaccgtacccatattacgcttaaaaagatggaagtgtggcataacgag
aaagagccttaccgcatcaagctagcctatatgatagccaaggtgaataatatcctggat
gaaagcaagcagggcacgaaggaacgttatagttgtgctgaagagcttattgcggatctg
aacgttattgacgacagcttgcgtcatcattttgcggattatgtggcagatacttatatt
cagaagatgattcgtcaggtagagctgttcggcttccatacggctacgctggatgtacgc
cagcatagtcaggagcatgaaaatgcaatgactgaaattctctctaaaatgaatattgtt
gcggattatggcaagctgcctgaggaagagaaaatagacctgctggaaaagctgctgaat
gagcctcgtccgattacatcgccgtatttgaaatatagcgacagcactcaagaatgtctt
gatgtatatcgtacgatttatctggctcaggaggaatttggcaagcaatccattacaagc
tacttgatcagtatgactcagggagcaagcgatttactggaagttatggtgctgtctaaa
gaagtggggctgttccgtatcgagaaagatggtacagtcgtatgtacattgcaatccgtt
cctctgtttgaaacgatagacgatctgcatgctgcccctagtattatgaaaaggctgctg
aacttgcctgtatatcgccaatccgtagcagcaatggatcagctccaagagatcatgctg
ggatattcagatagtaacaaggacggcggtgtggttactgcgaactgggagcttcgggtt
gcgatgaacagcattacggaagtggttaatgagttcggtgtaaaagtgaagttcttccat
ggacgtggaggagcactgggacgcggaggaatgccgcttaaccgtagcattttggcccaa
cctccacatacgatcggaggcggaatcaagattacggagcagggtgaggtactctcatcc
agatactcgctcaagggcatcgcttatcgaagcttggaacaggcaacgtcagctctgatt
accgcagttgcgtataaccgttccggtaagaaggaagtgttcgaggagagctgggaggag
atcatcgcccatatttccgaggtatcgctggagaagtatcaggatttgattttccgcgac
ccggatttctttgctttcttcaaggaatcaacgccattgcctgaggtgggcgaactgaat
atcggctctcgtccatccaaacgtaagaacagtgaacgttttgaggacttgcgcgctatt
ccatgggtttttgcatggacgcaaagccggtacttgctacctgcttggtacgcggctgga
acagggctgcaaagcttctatcagaacaatgaggataacctcaaggtgctgcaaacgatg
ttcaaggaatcagcttttttccgctcccttattgatacactgcaaatggcgattgcgaag
gcggatttgctgattgcagaggaatatgcagggatgtccgataatgaagaggctcgccaa
cgcattttcggacaaatttcagaggaattcaagctgacatccgagctgattttgaaaata
acaggacaatcggaaattctggacgatgtgccggtaattcaggagtccatccgattgcgt
aatccttatgtcgacccgttaagctacttgcaggttcagttgcttagtgagctacgcgaa
ctacgtaaccagaatggggatgatgcggagctgctacgtgaggtgctgttaaccattaac
ggaattgccgcagggctgagaaacacgggctga

DBGET integrated database retrieval system