KEGG   Paenibacillus terrae: HPL003_05830Help
Entry
HPL003_05830      CDS       T01668                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00500  Starch and sucrose metabolism
pta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HPL003_05830
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HPL003_05830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: AET57931
UniProt: G7VZS0
LinkDB All DBs
Position
1221567..1223057
Genome map
AA seq 496 aa AA seqDB search
MKRNHTMMQFFEWNVEADGSHWKKLARLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTREDLLEAVTACVRHGVTVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIEGWTKFTFPGRQGQYSTFQWNFEHFNGTDYDASQDRTGIYRILGK
NKSWSEHVDDEFGNYDYLMFANIDYNHQEVRKEMIRWGKWLVDTLQCNGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLESCQKFLDTIDYKIDLFDVSLHYKLHSASLG
GKDFNLSTIFEDTLVQTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGQTPVKGKQAELDPLLYARYHKAYGEQKDYLDDPHTIGWVRQGASELK
GSGCAVVVTNADDGKKRMYVGKQRAGEQWTDLTGRHDHIVQIEQDGYGVFPVRAGSVSVW
ALPAEDDSPEADDVDA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcagtttttcgagtggaacgtcgaagctgacggctcc
cattggaagaaacttgcccgcctggcaccggaattgaaggccaaaggaattgatgcgata
tggattccacctgtcaccaagggccaatcccccgaggatacggggtacggcgtctatgac
ctttacgatctgggtgaatttgatcaaaagggtgcggtgcgcaccaaatacggtaccaga
gaagaccttttggaggcagttaccgcctgcgttcgtcacggcgtgaccgtctatgtcgat
ctggtcatgaaccataaagctggcgcggatgaaaccgaagtattcaaggtcgtcgaggtc
aacccggataaccgcaatgaggtcatttccgagccgttcgatatcgaaggctggactaaa
tttacgttccccggtcgtcagggccagtattccacatttcaatggaattttgaacatttt
aacggaaccgattacgatgcaagtcaggaccgaacgggaatttatcgtattttgggcaaa
aataaaagctggagcgagcatgtagatgatgaattcggcaattatgattatttgatgttc
gccaatattgactataatcatcaggaagtgcgcaaggagatgatccgctggggcaaatgg
ctcgtggataccctgcaatgcaacgggtttcgcctggacgcaatcaagcatatcaatcat
gaatttgtacgggagttcgcgacggaaatgatcaaaaagcgcggacaggacttttatatg
gtcggcgagttttggaaacccgatctggaatcatgtcaaaaatttctggacactattgat
tataaaatcgacctgtttgacgtatccctccactacaagctacatagcgcttccttgggt
ggaaaggatttcaatttaagcaccattttcgaggatacgctagtccagactcatcccctg
aactccgttacttttgtcgacaatcatgattcccagccccacgaagctctggaatcgtgg
gtagaggactggtttaagcccagcgcctacgcgctcatcttgctgcgcaaggacggttac
ccctgcgtattctacggcgattactacggcattcaagggcaaacgcccgtgaaaggcaag
caggccgagctggatccgctcctgtacgcccgatatcataaagcctatggtgagcaaaag
gattacttggatgatccccatacgattggatgggttcgtcagggcgcgtctgaactgaaa
ggctccggctgtgccgtggtggtcaccaacgcggacgacggaaaaaagcgtatgtatgtg
ggaaaacaacgcgcaggagagcaatggaccgatctgacgggccgtcacgaccatatcgta
cagattgaacaggacggctacggcgtattcccggttcgtgccggcagtgtatcggtgtgg
gcgcttcccgccgaggatgacagcccggaagcagacgacgtggacgcttaa

DBGET integrated database retrieval system