KEGG   Paenibacillus terrae: HPL003_06095Help
Entry
HPL003_06095      CDS       T01668                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00500  Starch and sucrose metabolism
pta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HPL003_06095
Enzymes [BR:pta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HPL003_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_14 CBM_25 Alpha-amylase CBM53 Glyco_hydro_42 Cyc-maltodext_C hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AET57982
UniProt: G7VZX1
LinkDB All DBs
Position
1307315..1310740
Genome map
AA seq 1141 aa AA seqDB search
MTLYRSLWNKGCLILLSLVLSLTAFIGSPSNTASAAVADDFQASVMGPLAKINDWGAFKK
QLQTLKSNGVYAITTDVWWGYVESAGDNQFDWSYYKTYADAVKEVGLKWVPIISTHKCGG
NVGDDCNIPLPSWLSSKGSADEMQFKDESGYANNEALSPLWSGAGKQYDELYASFAENFA
GYKSIIPKIYLSGGPSGELRYPSYYPAAGWSYPARGKFQAYTETAKNAFRAAMNEKYGSL
DKINAAWGTKLSSLSQINPPSDGDGFYTNGGYNSTYGKDFLSWYQSVLENHLGVIGAAAH
KNFDSVFGVRIGAKISGLHWQMNNPAMPHSTEHAGGYYDYNRLIQKFKDADLDLTFTALE
MNDSGTAPNYSLPSTLVDTVSSIANAKGVRLNGENALPTGGSGFQKIEEKITKFGYHGFT
LLRINNLVNSDGSPTGELDGFKQYIISKAKPGDNGGGTGNKVTIYYKKGFNSPYIHYRPA
GGNWTAVPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYLFSTGTST
YTPGDTSKAGTITSGTPSGTNPGEGGGTTNKVTIYYKKGFNSPYIHYRPAGGNWTAVPGV
KMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYFFTTGTSTYTPGSNGAAG
TVQTGSPSGGSTPTDPESPSNPTPLSTDWSKQSIYFIMTDRFSNGDTSNDNYGGFNSNNS
DMRKWHGGDFQGIINQLDYIQNMGFTAIWITPVTMQKSEFAYHGYHTYDFYAVDGHLGTM
DKFKELIRKAHDKNIAVMLDVVVNHTGDFQPANGFAKAPFDKADWYHHNGDITGADYSSN
NQTKIENGDVAGLDDLNQDNPATANELKNWIKWLLNESGVDGLRVDTAKHVPKGFLKDFD
QAANTFTIGEIYSGDPAYVGDYTRYLDAALDFPMYYTIKDVFGRDQSMIKIKERYSDDRY
YRDAQTNGVFIDNHDVKRFLNEASGKPGASSDKWPQLKAALGFTLTSRGIPIIYQGTEQG
FSGGDDPANRENVVFNANHELYQYIAKLNRVRNSHPALQNGSQKEKWADDSFYSFQRSKN
GDEAIVLINNSWSSQTRTISNFDNLSNGTRLTNQLSNDSIQINNGSITVTLAPKEVKIFT
R
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
ttgaccttgtatcgaagtctatggaacaaagggtgcctgattctgcttagccttgtgctg
tctctgaccgccttcattggctcaccctccaatacggcaagcgctgcggttgctgatgat
tttcaggcttccgtcatggggccgctggcgaaaatcaatgactggggcgcattcaaaaag
caactgcaaacgctgaaaagtaacggtgtatatgccatcaccaccgacgtctggtggggt
tatgtggagagcgcaggagataaccagttcgattggagctactacaagacctatgcagat
gctgtgaaagaagtgggactgaagtgggttcccatcatttctacgcataagtgcggcgga
aatgtgggggatgactgcaacatcccgctcccaagctggctgtccagcaagggcagtgca
gatgaaatgcagttcaaggacgaaagcggctatgccaataacgaggccctttcgccactg
tggagcggagctggcaagcaatatgacgagctgtatgcctcgttcgctgaaaattttgcc
gggtacaaaagcatcattcccaaaatttatttaagcggtggcccttccggtgaattacga
tacccgtcctactatccggcggcaggatggagctacccggcacgtggcaagttccaggcc
tataccgaaacagccaaaaatgcgttccgcgcggccatgaatgaaaagtatggatcatta
gacaagattaatgcggcttggggtaccaagctaagcagccttagccaaatcaatccgccg
agtgacggggacggattttacacgaacggcgggtataattccacctatggtaaggatttc
ttgtcgtggtaccaaagcgtgcttgaaaatcatctgggcgtcatcggagcagctgcccac
aaaaactttgattctgtgttcggtgtccgtatcggagccaagatttccggcctgcactgg
cagatgaacaaccctgcaatgcctcacagcactgagcatgcaggtggatattatgattac
aatcgtctcatacagaagttcaaggatgctgatctggatttgacctttactgcactggag
atgaacgacagtggcacagcaccaaattattcgttgccgtccacactggtagacaccgtc
tcctcgatcgcgaatgccaagggcgttcgcctgaatggtgaaaacgcgctcccaacaggc
ggcagcggcttccagaaaatcgaagaaaaaattacgaagtttggttatcacggctttacg
ctattgcgcatcaacaatctcgtcaacagcgacggctcaccaaccggtgaactggatgga
ttcaaacagtatattatcagcaaggccaagcctggtgataacggcggcggtacaggtaac
aaagtaaccatatactacaaaaaaggcttcaactcgccttacattcactaccgcccggct
ggcggaaactggaccgccgtgcctggcgtgaaaatgcaggatgccgagattagcggctat
gccaaaatcaccgttgatatcggctctgcttcccaattggaggctgcctttaatgatggc
aacaacaactgggacagcaacaacaccaaaaactaccttttcagcacgggcacttctact
tacacgccaggcgacaccagtaaagcaggaaccattacatcaggtactccatccggtacc
aaccccggtgaaggcggcggtactaccaacaaggtaactatttactacaaaaaaggcttc
aattcgccttacattcactaccgtccggctggcgggaattggactgccgtacccggtgtg
aaaatgcaggatgccgagattagcggctatgctaaaattactgtcgatatcggttctgcc
tcccaattggaagccgcttttaatgacggtaataacaactgggatagcaacaacaccaaa
aactacttcttcaccacaggtacttctacctacacgcccggctctaacggagccgcagga
actgtccaaacggggtcgccttcgggcggctctactcccactgatccagagagcccttcc
aatcccactccccttagcacagactggagcaaacagagcatttactttatcatgacagac
cgtttcagcaacggggatacatcgaacgataattacgggggcttcaactccaacaacagc
gacatgcgcaagtggcatgggggcgattttcaaggcattatcaaccagctcgattatatt
cagaatatgggttttaccgccatctggattactccggtaacgatgcaaaagagcgaattc
gcttaccacggctaccatacatatgatttttatgcggtagacgggcatctcggtacaatg
gacaagttcaaggagctgatccgtaaagcgcacgacaaaaatatcgctgttatgctggac
gtagttgtcaatcacacaggcgattttcaaccggcgaacggcttcgccaaggcccctttt
gacaaagcagactggtatcatcacaatggcgacatcactggggcagattacagctccaac
aaccaaacgaaaatcgaaaacggagacgtggccggattggatgacctgaatcaggacaac
cctgcaaccgcaaacgagctcaaaaactggatcaaatggctgttgaatgagtcgggggtc
gacggactgcgggtagacaccgccaagcatgtacccaaaggctttttgaaggattttgac
caagccgccaacactttcaccatcggtgagatttacagtggcgatcccgcttatgtaggc
gattatacccggtatctcgatgctgcactggattttccgatgtattatacgatcaaggat
gtcttcggacgtgatcaatccatgatcaaaatcaaggaacgctactcggatgatcgttac
tatcgcgatgctcagaccaacggcgtatttatcgacaatcatgatgtaaaacgtttcctc
aacgaggcctccggcaagcctggtgccagctctgacaaatggccccagctcaaggccgcc
ttgggctttactttgacatcgcgcgggattccaatcatttatcaaggcaccgagcaagga
tttagcggcggagatgatcccgccaaccgtgaaaacgtcgtgtttaatgctaatcacgag
ctgtaccagtacatcgccaagctgaaccgtgtacgcaacagccaccctgctctgcaaaac
ggtagccaaaaggaaaaatgggcggacgactccttttacagcttccagcgctctaaaaac
ggcgacgaggccatcgtactgatcaacaactcgtggagcagtcaaacccgcacgatcagc
aactttgataacctgtccaacgggacccgtctgaccaaccagttaagcaacgacagcatt
cagatcaataacggttcgatcaccgtgactctcgctccgaaggaggttaaaattttcact
agatga

DBGET integrated database retrieval system