KEGG   Paenibacillus terrae: HPL003_06765Help
Entry
HPL003_06765      CDS       T01668                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase (phosphoenolpyruvate mutase)
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pta  Paenibacillus terrae
Pathway
pta00440  Phosphonate and phosphinate metabolism
pta01100  Metabolic pathways
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    HPL003_06765
Enzymes [BR:pta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     HPL003_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL Pox_vIL-18BP
Motif
Other DBs
NCBI-ProteinID: AET58116
UniProt: G7W3M9
LinkDB All DBs
Position
complement(1443004..1443903)
Genome map
AA seq 299 aa AA seqDB search
MKKTKQLRELVNSQKLEFIMEAHNGLSAKIVEEAGFKGIWASGLSISAAMGVRDNNEASW
TQVLDVLEFMSDATSIPILLDGDTGYGNFNNARRLVKKLEQRHIAGVCIEDKRFPKMNSF
INGQGQTLADIEEFSGKIKAMKDTQTDEDFTVVARVEAFIAGKGLKVALQRAEAYRKAGA
DAVFIHSKRADAAEIEAFMKEWAGRLPIVIVPTKYYTTPTVRFQELGISLVIWANHNLRA
SIQAMQHLSNRIYRDESLVHIEKSVATLEEVFRLQGVEELQAAERQYFPSSEPDSGEHV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaaagcagctaagagagttggtcaattctcaaaaactggagtttatcatg
gaagctcataatggtctgtcagccaaaattgtggaggaggcggggtttaaaggaatttgg
gccagcgggctatccatctctgcagcgatgggagtcagggacaacaatgaggcctcctgg
acgcaggttttggatgttttggaattcatgagtgatgctacctccatcccgattttgctg
gacggagatacggggtacggcaatttcaataatgcaaggcggctggtaaagaagctggag
cagcgccatattgcgggggtatgcatcgaagataagcggttccccaaaatgaattctttc
attaacggtcaagggcagactttggctgatatcgaggagttttccgggaaaataaaagcg
atgaaagacacgcaaaccgatgaggactttacagtggtggccagggtagaggcatttatt
gctgggaaagggcttaaagtggcgctgcagagggcagaggcgtaccggaaggcaggagcc
gatgccgtatttatacacagcaaaagagcggatgccgcagagattgaagcattcatgaag
gaatgggccggaagattgccgatagtgatcgtgcctaccaaatactatacgactccaacc
gtcaggtttcaggagttggggatcagccttgtgatttgggcaaaccataatttgagagca
tctattcaagccatgcagcatttatctaaccggatttatcgggatgaaagtcttgttcat
attgaaaagagtgtcgccaccctcgaagaagtattccggcttcaaggggtcgaggagctg
caagccgcggagcgccaatactttccgtcgtcagaaccggattcgggtgagcacgtataa

DBGET integrated database retrieval system