KEGG   Paenibacillus terrae: HPL003_14170Help
Entry
HPL003_14170      CDS       T01668                                 

Definition
(GenBank) hypothetical protein
  KO
K06925  tRNA threonylcarbamoyladenosine biosynthesis protein TsaE
Organism
pta  Paenibacillus terrae
Brite
KEGG Orthology (KO) [BR:pta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_14170
Transfer RNA biogenesis [BR:pta03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    HPL003_14170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TsaE TIP49 dNK
Motif
Other DBs
NCBI-ProteinID: AET59585
UniProt: G7W0G4
LinkDB All DBs
Position
3052825..3053304
Genome map
AA seq 159 aa AA seqDB search
MTISQEQFTFRSAGEAQTGVLAGFLAGKAVSGTVIVLDGDLGAGKTAFSKAFASHLGVPG
IVNSPTFTLIKEYEGRLPLYHMDVYRITQDEAEDLGLDEYFYGTGVCLVEWGSIIPDMLP
EQRLHMYIETTDVEERLIHLTGYGEPYEQWCRSLRENGV
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttcgcaggaacagtttacgttccgttctgccggagaggcgcagaccggggtt
ttggcagggtttttggcaggcaaagcggtttccggaacggtgatcgtgctggatggagat
ctgggagcgggcaaaaccgctttttccaaagcctttgccagtcatctgggtgtcccgggt
atcgtgaacagcccaacctttacgctcattaaggagtacgaaggccgattgcccttgtac
catatggatgtgtaccgtattacacaggatgaggcagaggatcttgggctggacgaatat
ttttacgggacaggcgtatgtctggtcgaatggggcagtattataccggatatgttgccg
gagcagcggcttcacatgtatatagaaacaacagatgtggaggagcgcttgattcacctg
accgggtacggcgagccttatgaacaatggtgccgcagtttgcgggagaatggagtttga

DBGET integrated database retrieval system