KEGG   Paenibacillus terrae: HPL003_15415Help
Entry
HPL003_15415      CDS       T01668                                 

Definition
(GenBank) tRNA (guanine-n(7)-)-methyltransferase
  KO
K03439  tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
pta  Paenibacillus terrae
Brite
KEGG Orthology (KO) [BR:pta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_15415
Enzymes [BR:pta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     HPL003_15415
Transfer RNA biogenesis [BR:pta03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    HPL003_15415
 Prokaryotic type
    HPL003_15415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_4 Methyltransf_31 Methyltransf_23 Methyltransf_25 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: AET59832
UniProt: G7VXS2
LinkDB All DBs
Position
3309306..3310022
Genome map
AA seq 238 aa AA seqDB search
MRLRGRKGIRESLEEQQDLVILEPGQYKGKWQQLFGNDRPIHVEFGMGKGRFISQMSYRN
PEINYIGFDMYDELVRRAAEKSRLAWSDTEVDTPPNIKLALANIEQIENVFEPGEIERIY
LNFSDPWPKAKHARRRLTHPRFLDKYRQLLNSKGQIHFKTDSETLFEFSLNSFADSGLQM
TNISLNLHREGINEEHVMTEYEHKFMGKGMNIHRVEVLIGKDALEEYEKIRLEKYGKS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttacgcggaagaaaaggaatacgagaaagtttggaagaacagcaggacctggtt
atcttggagccgggacagtataaaggaaagtggcagcagctttttggcaatgatcgtccg
attcatgtggaattcggtatgggcaaaggtcggtttatcagtcaaatgagctatcggaat
ccggaaatcaattatattggctttgatatgtatgatgagctggtgcgtcgtgctgcggaa
aagtcgcgtctggcctggagtgacacagaggttgatacgccgcctaatatcaaattggcg
ctggcgaacattgaacagattgagaatgtttttgaacctggggaaattgagcgtatttat
ttgaattttagcgatccgtggcctaaagccaagcatgcgcgtcgtcgcttgacgcatccg
cgctttttggacaagtaccgtcagcttttaaacagcaagggacaaattcatttcaaaacc
gattcggagacgctgtttgagttctcgctgaattcatttgccgacagcggtttgcaaatg
acgaacatatcgttgaaccttcatcgtgagggtatcaacgaagagcatgtcatgactgaa
tatgagcataaatttatgggcaaaggcatgaacatccatcgtgtcgaggtgctaatcggc
aaagatgctttagaagagtatgagaaaatacgtcttgagaagtatggtaaatcataa

DBGET integrated database retrieval system