KEGG   Paenibacillus terrae: HPL003_15555Help
Entry
HPL003_15555      CDS       T01668                                 

Definition
(GenBank) ATPase involved in DNA repair
Organism
pta  Paenibacillus terrae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HIP1_clath_bdg PI_PP_I
Motif
Other DBs
NCBI-ProteinID: AET59859
UniProt: G7VXU9
LinkDB All DBs
Position
3339802..3341826
Genome map
AA seq 674 aa AA seqDB search
MTTPDRTRVTVEIYGTSYKLVGSNTDYMKQVANYVDERMHSISQAHSRLDMPRIAVLAAV
HMAEEAVQIQEIQSHMNRLAGERAELRGELAQLQTALGEQQQKNTDMQQSFAQLKEEKET
VLKKLTDTESASAREIAELKAKLEQQEKKAAELENGQKQAERQLEESRQEASRKLKEQQE
AANARIRQLEEQTKKELAEAVKQAEAKLSAAEKAHQERQRTELDKLRSALQQEHSRKVTE
WQDKWSGLNGQLEQERKQAELALNEEKLQHQEAEKRAEEAALEQEIRVEELQEQLEQVQA
GSTELSSRLGEAQEQVAALKQQQSELESMLETQRQAATEREQADTLAREKLQSRYDELAA
EAKATQQQAAKLEEEQRRMQKLLEQAHVSSRKLQSELATLAESEKSWQKLAEERQLAVDE
LELSVLEVREQKETVQEQLQHAVAEVEAVNHKFAAQQQRLLQLEARIKELSPELIRVQDE
LEKTILREQEGTKAYKTLQEQYGSMKSRAEQLGQNIKQLQREDSERRKELERAEEESLEW
QLKYEQLKAEAERLEAEDAARKKEFASWEREIAVTVEQKEQLQEEIRLAVEAAEAAKAEQ
QSVDQERMALQSELEEVGQKYELAAHQLRLLQVQQDVDRENTEKISTELRQLQEEYTKLQ
SEYNEWIELIEQDQ
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgactacaccagatcgtactcgcgtcactgtagagatctacggtacttcttataaactc
gtcggcagtaataccgattatatgaagcaggttgccaattacgtggatgaacgcatgcat
agcatttctcaggctcattcgcgtcttgatatgccccgaattgccgtactggctgcggtt
catatggcagaagaagctgtacaaattcaggaaattcagagtcatatgaaccggttggcc
ggggagcgggcggagcttcggggcgaactggctcaactccagacggctcttggagaacag
cagcaaaaaaatacggatatgcagcagtcttttgcccaattgaaggaagagaaggaaacg
gttctgaaaaaattgacggacaccgaatccgcatcagccagggaaattgccgaattaaag
gcgaagctggaacagcaggagaaaaaggcggcggaactcgaaaatggacaaaagcaggct
gaacgccaactggaggagtcccgtcaggaagcttcccgtaagctgaaagagcagcaggag
gcggcaaatgcccgtatccgccagttggaggagcaaaccaagaaggagctggccgaagcg
gtcaagcaggcggaagccaagctgtcggcagcggaaaaggctcatcaggagcgtcagcgc
acagagctggacaagctgcgttctgctttgcagcaggagcatagccggaaggtcaccgaa
tggcaggacaagtggtccgggctgaacgggcagttggagcaggagcgtaaacaggcggaa
ctggcgttgaatgaagaaaagctccagcatcaggaagcggagaaacgggccgaggaagct
gcactggagcaggaaattcgggtcgaggagcttcaagagcaattggagcaggtgcaagca
ggcagtacagagctgtcttcccgtctgggagaggctcaagagcaggttgcagcattgaag
caacagcagtccgagctggagtctatgctggaaacgcagcgacaggctgcgacagagcgc
gagcaggcggatacgcttgcgcgtgaaaagctgcaaagccgttacgatgaattggcagcg
gaagccaaggcaacgcagcagcaagcggccaagctggaggaagaacagcgccggatgcag
aagttgctggagcaggcgcatgtgtcctcccgcaaactgcaaagtgagttggctacactg
gccgaaagcgagaaatcttggcagaagcttgcagaggaacgccagctcgcagtagatgag
ctggagctttcggtattggaagtacgtgaacagaaggaaactgtacaggagcaattacag
catgccgtggctgaggttgaagctgtaaaccataagtttgctgcacagcagcaacgtcta
ttgcagttggaagcgagaatcaaggaactttcacctgagctgattcgcgttcaggacgag
ctggagaagacaatcctgcgtgagcaagagggaacgaaggcttacaaaacgcttcaggag
cagtatggaagcatgaagagtcgggcagagcaactgggacagaatatcaagcagctccaa
cgtgaagatagcgaacggcggaaggaactggagcgcgccgaagaagaatcactggaatgg
cagcttaaatatgagcagttgaaggccgaagcggaacgtttggaggccgaagatgctgcc
cgtaagaaagaatttgcctcgtgggaacgagaaatagccgtaactgtcgaacaaaaggaa
cagcttcaagaggaaattcgtctggccgttgaagctgccgaggcagcgaaggctgagcag
caatctgtagatcaggaacggatggctttacagtccgagctggaggaagtcggtcagaag
tatgagctggcggctcatcagcttcgtcttttacaggttcaacaggatgtggatcgggaa
aatacggagaagatatcgacggaattacgtcaattgcaagaagagtataccaagcttcaa
tccgagtacaatgagtggattgaattaattgaacaggatcagtag

DBGET integrated database retrieval system