KEGG   Paenibacillus terrae: HPL003_18410Help
Entry
HPL003_18410      CDS       T01668                                 

Definition
(GenBank) polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
pta  Paenibacillus terrae
Pathway
pta03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HPL003_18410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pta03019]
    HPL003_18410
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_18410
Enzymes [BR:pta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     HPL003_18410
Messenger RNA biogenesis [BR:pta03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HPL003_18410
Transfer RNA biogenesis [BR:pta03016]
 Prokaryotic type
  tRNA degradation factors
   HPL003_18410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C S1 PNPase KH_1 SPATA25 S1_2
Motif
Other DBs
NCBI-ProteinID: AET60424
UniProt: G7W2S9
LinkDB All DBs
Position
3916558..3918660
Genome map
AA seq 700 aa AA seqDB search
MEQRVEMQLGGRKLVLETGRLAKQANAAVKVSYGETVVLCTVTASNAPKDLDFFPLTVNY
EERLYAVGKIPGGFIKREGRPSQKAILSSRLTDRPIRPLFPEGFRNDVQVLNLVMSVDQD
CEPEIAAMIGTSAALSISDVPFNGPIGGVAVGRVDGQFVINPDIAQQNASDLYLVVAGTK
DAIMMVEAEGNEIPEEVMLEAIMFGHDEIKNIVAVIEQLVQVAGKEKMQVKLHAVDEKVN
SEVRSYAAERLVEAVKIVEKHARQEAIDAVNEETVAHFEVQYIETPELLKDVSEVLYDIV
KEEVRRLITHDKVRPDGRKLDEIRPIESDTSILPRTHGSGLFTRGQTQALSVCTLGALGD
VQILDGIDLEETKRFMHHYNFPPFSVGEARPLRAPGRREIGHGALGERALSKVIPSETEF
PYTIRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGVAMGLIKDGEHVSVLTDI
QGMEDHLGDMDFKVAGTAEGVTAIQMDIKINGIDRQILQDALNQAREGRLFILSKMMEAI
QTPREQLSPYAPKIMTMHINPDKIRDVIGAGGKIINKIIEETGVKIDIEQDGRVFIASTN
QEMNEKARSIIEGIVKEVVIGEIYIGTVKRIEKFGAFVEILPGKDGLVHISQLSTERVAK
VEDVVAIGDTITVKVTEIDQQGRVNLSRKAVLTAEAPAKA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacgtgtggaaatgcagctcggcggaagaaagctggtgctggaaacaggacgt
cttgcaaaacaggccaatgccgcagttaaagtaagctatggcgaaacggttgttctctgt
accgtgaccgcttccaatgcgccgaaagatttggacttttttccactgacggtgaattat
gaagaaagattgtatgctgtgggaaaaatcccaggcggatttattaaacgtgaaggacgt
ccaagtcaaaaagcgattttgtccagccgtctgacagaccgtccgatccgcccattgttc
ccggaaggcttccggaatgatgtacaggtattaaacctggtgatgagtgtcgatcaggat
tgtgagccggaaattgcagcgatgatcggaacctcggcagcgcttagcatttcggacgta
ccttttaacggaccgattggcggagttgctgtaggccgtgtggacggacaattcgtgatt
aacccggacattgcgcagcagaatgcaagtgatttgtatctggttgtagccggaacgaaa
gatgccatcatgatggtagaagcggaaggcaacgaaattccggaagaagtcatgctggaa
gcaatcatgtttggccatgacgagattaagaacattgtggcggtcattgaacaactggtt
caggtggcaggtaaagagaaaatgcaggttaaactgcatgctgtcgatgaaaaagtgaac
agcgaggttcgttcatatgcggctgaacgtttggtggaagccgtcaaaattgtagaaaaa
catgcccgtcaagaggcgattgatgcagtcaacgaagagacggttgcacattttgaagta
caatacatagagacgcctgagcttttgaaagacgtgagcgaagttctctatgatatcgtt
aaagaagaagtccgtcgtctgattacgcatgataaagtgcgtcctgacggtcgtaagctt
gacgagattcgtccgatcgaaagcgatacgagcattttgccgcgtacgcatggctcgggc
ttgttcacacgcggtcaaacacaagcgcttagcgtttgtacacttggcgcattgggtgat
gtgcaaattttggacggcattgatctggaagaaacgaagcgtttcatgcatcattacaat
ttccctccattcagtgtaggcgaggctcgtcctttgcgtgcgccgggtcgtcgtgaaatt
ggacatggtgctcttggtgagcgtgcgctttctaaagtcattccttctgaaactgaattt
ccatatacgattcgtctcgtttccgaggtgctggaatcgaatggctcgacttctcaggct
agtatctgcgcaagcacactggctatgatggatgcgggtgtaccgattaaggctccggtt
gcaggtgtagcgatgggattgatcaaggacggggagcatgtttccgtgttgaccgatatc
cagggtatggaagatcacttgggtgatatggactttaaagtggctggtacagcagaaggc
gtaactgctattcaaatggatatcaagattaacggtatcgaccgtcaaattttgcaggat
gcgctcaatcaagccagagaaggacgtctgttcattcttagcaaaatgatggaagccatc
cagacgccgcgtgagcaattgtctccgtatgcgccgaaaattatgacgatgcacattaac
ccggataaaatccgtgatgttattggtgcgggtggtaaaatcattaacaaaatcatcgaa
gaaaccggcgtaaaaattgatatcgaacaggatggtcgtgtattcatcgcttccacaaac
caagagatgaatgaaaaggcgcgttccattattgaaggtatcgtgaaagaagtcgtgatc
ggagagatttacatcggcacagtgaagcggattgaaaaattcggtgcattcgtcgaaatt
ttaccgggcaaggacggtctggttcatatttcccaactgtctactgaacgtgtagccaaa
gttgaggatgtagttgctattggagatacgattacggtgaaagtaaccgaaattgatcaa
caaggccgtgttaatttgtcccgtaaagctgttctgacggctgaagctcctgcaaaggcc
tag

DBGET integrated database retrieval system