KEGG   Paenibacillus terrae: HPL003_20285Help
Entry
HPL003_20285      CDS       T01668                                 

Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00020  Citrate cycle (TCA cycle)
pta00620  Pyruvate metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
Module
pta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_20285
   00020 Citrate cycle (TCA cycle)
    HPL003_20285
   00620 Pyruvate metabolism
    HPL003_20285
Enzymes [BR:pta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HPL003_20285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H ATP-synt_ab_Xtn Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AET60795
UniProt: G7VRY8
LinkDB All DBs
Position
4354367..4355980
Genome map
AA seq 537 aa AA seqDB search
MAKFEYKFPELGEGLHEGEIIKMHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEV
FAKDGDVFNIGQVVAVIDAEGELPEQEEAPEAPAASSEPSAAAQGGAAGTARFEYKFPEL
GEGLHEGEIIKMHIKPGDKVTDEDIIMEVQNDKAVVEVPCPVNGTVQEVFAKDGDIFNVG
QVVAVIAAEGELPEQEEAPAATKQEQDAAQGGANTKQAAAPAATNKDVLATPSVRKFARE
QGVNIAQVSGSGKNGKITKEDVEAFKNGGGQAAAPAAKETAKVQEPAKKEAKAAAPSAPA
ADPRAEEDRVPFKGIRKAIANAMVKSAYTAPHVTIMDEVDVTELVAFRTRMKPIAEKKGT
KVTYLPFIVKALVAASRQFPALNASIDEEANEIVYKKYYNIGIATDTDNGLIVPVIKDAD
RKSIWMIADSIRDLAVRGRDGKLAANEMRGSTISISNIGSAGGMFFTPIINFPEVAILGT
GRISEKAVVKNGEIVAAPVMALSLSFDHRIIDGATAQNFMNYIKQLLANPELLVMEV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaatttgaatataaattcccggagctgggtgaaggtcttcacgaaggcgaaatc
atcaagatgcacatcaagcccggcgacaaagtaacagatgaagatatcatcatggaagta
caaaacgacaaggctgtagttgaagttccatgtccggtcaatggtacggttcaagaagta
tttgccaaagacggagacgtctttaacataggtcaagtcgtggctgtaatcgatgcagaa
ggtgaacttcctgaacaggaagaagcaccggaagcgccagctgctagctctgagccaagt
gctgctgcacaaggcggagctgcaggtacagctagatttgaatataaattcccagagctg
ggtgaaggtcttcacgaaggcgaaatcatcaagatgcacatcaagcctggcgacaaagta
acagatgaagatatcatcatggaagtacaaaacgacaaggctgtagttgaagttccatgt
ccggtcaatggtacggttcaagaagtatttgccaaagacggagacatctttaacgtaggt
caagttgtggcagtaattgctgcagagggtgagcttcctgaacaagaagaagcaccggct
gccactaaacaagaacaggatgctgcacaaggcggagctaacacaaaacaagctgcagct
cctgctgcaacaaacaaagacgtgctggcaactcctagcgtacgcaaatttgcacgtgag
caaggtgtaaacatcgctcaagtgagtggctccggcaaaaatggtaaaatcactaaagaa
gatgtagaagctttcaaaaatggtggaggccaagcggctgcaccagcagcgaaagaaact
gcaaaagtacaagagccagctaaaaaagaagcgaaagcagcagcgccatccgcaccagca
gcagatccgcgtgctgaggaagatcgcgtaccatttaaaggtatccgcaaagcgattgcc
aatgctatggttaaatcggcttacacagctccacacgttacgattatggacgaagtggac
gtaaccgagctggttgctttccgtactcgtatgaaaccaatcgctgagaagaaaggcacg
aaagtaacatacctgccattcatcgtaaaagcattggttgcagcttcccgtcaattcccg
gctctgaatgcctcgatcgacgaagaagccaacgaaatcgtctacaaaaagtactacaac
atcggtattgccacagatacagacaatggtctgatcgttcctgtaattaaagatgctgac
cgtaagagcatctggatgatcgctgattccattcgtgatctggctgtacgcggtcgtgat
ggtaaactggctgccaatgagatgagaggaagcacaatttctatctctaacatcggttcc
gcaggcggtatgttctttactccaatcatcaacttccctgaagttgcaatcttgggaact
ggccgtatcagtgagaaagcagtcgtgaaaaacggtgaaattgttgccgctcctgtaatg
gctctttccttgagctttgaccaccgtattattgacggtgcaactgctcaaaacttcatg
aactatatcaaacagctgctcgctaaccctgagttgcttgttatggaggtgtaa

DBGET integrated database retrieval system