KEGG   Paenibacillus terrae: HPL003_22290Help
Entry
HPL003_22290      CDS       T01668                                 

Definition
(GenBank) acetyl-coenzyme A synthetase (acetate--CoA ligase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pta  Paenibacillus terrae
Pathway
pta00010  Glycolysis / Gluconeogenesis
pta00620  Pyruvate metabolism
pta00630  Glyoxylate and dicarboxylate metabolism
pta00640  Propanoate metabolism
pta00680  Methane metabolism
pta01100  Metabolic pathways
pta01110  Biosynthesis of secondary metabolites
pta01120  Microbial metabolism in diverse environments
pta01130  Biosynthesis of antibiotics
pta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPL003_22290
   00620 Pyruvate metabolism
    HPL003_22290
   00630 Glyoxylate and dicarboxylate metabolism
    HPL003_22290
   00640 Propanoate metabolism
    HPL003_22290
  09102 Energy metabolism
   00680 Methane metabolism
    HPL003_22290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pta01004]
    HPL003_22290
Enzymes [BR:pta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPL003_22290
Lipid biosynthesis proteins [BR:pta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPL003_22290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AET61184
UniProt: G7VQJ5
LinkDB All DBs
Position
complement(4806658..4808247)
Genome map
AA seq 529 aa AA seqDB search
MTDQQQWLAPEYYNMTSEMEHHDASKTALKWLSETGDYEEITYGELLKKANRLAGGLAGL
GFNKGDRVLVIVPRRIIAYVIYLACLKLGLAVIPSSEMLRAKDIAYRLRHSEARGVIAWT
GVIGEVDKVDGDMPSLDYRIAVSSDDTVAEPGWLALNELMAGQKDTFEAVKTHRDDMAIL
AYTSGTTGNPKGVVHSHGWGYAHLRITSPWLDIQASDTVWATAAPGWQKWIWSPFLSVLG
NGATGFIYNGPFRPGRYLHFLQQYGIQVLCCTPTEYRIMAKTDGLDQYDLSQLRSAVSAG
EPLNQEVINKFQEQFNITIRDGYGQTESTLIIGNLKDAPLRTGSMGKSIAPGLVEIVDED
GVPLAPGQVGDIAVRADLPALFHTYYLDPERKAVSVHGDYFVTGDRARKDEDGYFWFEGR
GDDIIISSGYTIGPFEVEEALMKHDSVQECAAVASPDEIRGHIVKAYVVLKAGVEGSPEL
VKELQHHVKASTAPYKYPRKIEFIQELPKTSSGKIRRVELRELEKQSVL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
ttgacagatcaacagcaatggcttgcgcctgaatattacaatatgacttcggaaatggaa
catcatgacgctagcaaaacagcactcaagtggttaagcgaaacaggagactatgaggaa
atcacctacggagagctgctcaaaaaagctaatcgactggctggaggacttgcaggactg
ggatttaacaaaggagacagggttctggtcatagtaccacgtcgcattattgcgtatgtg
atttacctggcatgcttaaagctgggacttgccgttattccttcttccgaaatgcttcgg
gccaaggatattgcctatcgacttcgccattcagaagcacgcggggtgattgcctggacc
ggagtaataggtgaagtggacaaagtagacggggatatgccttccctggattaccgtatt
gcggtttccagcgatgacacagtagctgaacccggctggctggcgctgaatgagctgatg
gcaggacagaaagatacctttgaagctgtgaaaacgcaccgggatgacatggcaattttg
gcctatacctccggtaccacaggaaaccctaaaggtgtcgtacatagccacggctgggga
tatgcccatcttcggattacatccccctggctggatatccaagcctcggatacagtgtgg
gctacagctgcgccaggatggcaaaaatggatttggagtccgtttctatccgtattggga
aatggagcgaccggattcatatataatggtccatttcgtccggggcgctatttgcacttc
ttacagcaatacgggattcaagtgttatgctgtaccccaaccgaatatcggatcatggcg
aagacggatggtctggatcaatatgatctgtcccaattgcgcagtgcagtttctgcggga
gagcctcttaatcaggaggtcattaacaagtttcaggagcagttcaacattacaattcgt
gacggttacggccagacggaaagcactttgattatcggtaatttgaaggacgcgcctttg
cgcacaggttcaatgggaaaatccattgccccaggactggttgagatcgtagacgaggac
ggtgttccgctggctccgggccaagtgggcgatattgcagtgcgtgctgatctgccggca
ttattccatacgtattaccttgatccagagcgcaaagcggtcagtgtccatggagactat
tttgttacaggagatcgggcgcgcaaggacgaggatggatacttctggtttgaaggacgc
ggtgacgatatcattattagctctggttataccatcggtcccttcgaggtggaggaagca
ctcatgaagcatgactctgtacaggagtgtgctgcggtagccagccctgacgaaatccgg
ggacatattgtaaaagcctacgttgtactcaaagccggagtagaaggatcgccggagttg
gtgaaggaactgcaacatcatgtgaaagcatcgacagcaccttacaagtatccaagaaaa
atagagtttattcaggagcttcccaaaaccagctcgggtaaaataagaagagtggagctg
cgtgaactggagaagcagtctgtactgtaa

DBGET integrated database retrieval system