KEGG   Paenibacillus terrae: HPL003_24200Help
Entry
HPL003_24200      CDS       T01668                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pta  Paenibacillus terrae
Pathway
pta00450  Selenocompound metabolism
pta00970  Aminoacyl-tRNA biosynthesis
pta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HPL003_24200
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPL003_24200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pta01007]
    HPL003_24200
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_24200
Enzymes [BR:pta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HPL003_24200
Amino acid related enzymes [BR:pta01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HPL003_24200
Transfer RNA biogenesis [BR:pta03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HPL003_24200
 Prokaryotic type
   Other AARSs
    HPL003_24200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AET61558
UniProt: G7VV61
LinkDB All DBs
Position
complement(5239076..5241094)
Genome map
AA seq 672 aa AA seqDB search
MSNEKTFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYEVRYLTGTDEHGQKIEQ
KASAAGKTPQHFVDDIVAGIQDLWRKLDISNDDFIRTTEERHKNVVQEIFDRLLKQGDIY
KGEYEGWYSIPDETYYTETQLVDVVKDAEGNVAGGKSPDSGHPVELVKEECYFFRMSKYA
DRLLKFYEENPQFIQPESRKKEMINNFIKPGLEDLAVSRTTFDWGVKVKGDPKHVVYVWI
DALSNYITALGYGSSNTKLYDKFWPANVHIVGKEIVRFHTIYWPIMLMALDLPLPKKVFA
HGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDQLRYYLLREVPFGADGTFTPESFVDRVNS
DLANDLGNLLNRTVAMVDKYFEGKVPAYEANVTAFDGALEEMATATYSKVEEAMENMEFS
VALTVISQFISRSNKYIDETQPWNLAKDEDKRCELASVMVHLVESLRIASILLQPFLTRA
PYKIWDQLGVKEGELTTWDSGKQFGRIPEGTQLIKGNPIFPRLDSEQEVAFIVEAMTGGK
KPEEATAQVQPQNATEAGQEAPEAKEEIGIEDFAKVELRVAQVIACEPVKKADKLLKLQL
DLGYEQRQVVSGIAKFYTPEDMVGRKVICVTNLKPVKLRGELSQGMILAASHGDQLTLAT
VPESMPNGAIVK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgagaaaacattttacattacgacaccgatttattatccaagcgacaagcta
catatcggtcatgcgtacactacggtagccggagatgcaatggctcgctataagcggctg
cgtggctacgaggtgcgctatttgacaggaacggatgagcatggtcaaaagattgagcag
aaggcgagtgcggctggcaaaacaccacaacatttcgttgatgatattgtggcagggatt
caggatttatggcggaagctcgacatttccaatgacgattttattcgcacaacggaagaa
cgtcacaagaacgttgtacaggaaatttttgatcgtttgctcaagcaaggagacatttac
aagggtgaatacgaaggctggtacagcattcctgacgaaacctattacacggagacccaa
ctggttgacgtggtgaaggacgcagaaggaaatgtggctggaggtaaaagcccggacagt
gggcaccctgtagaactggtcaaggaagagtgttactttttccgtatgagcaagtatgct
gatcgtttactgaaattttatgaggagaacccgcagtttatccagccggaatcccgtaaa
aaagagatgattaacaattttatcaagccgggtctggaggatttggcagtatcccgtaca
acctttgactggggtgttaaggtgaagggggatccgaagcatgtcgtatacgtgtggatt
gatgcgctctccaactatattacagcgctgggctatggttcctccaataccaaactgtac
gacaaattttggcctgcaaatgtgcatatcgtagggaaggaaattgtacggttccatacg
atatattggccgatcatgctgatggcgctggatctcccgttgcctaagaaagtatttgca
catggctggctgctcatgaaggacggtaaaatgtccaaatccaaaggtaacgtcgttgac
cctgtaacgctaattgaccgctatggtctggatcaacttcggtattacttgttgcgcgag
gtgccattcggcgcggatggaacctttaccccagaaagcttcgttgatcgggtcaattct
gatttggcgaatgatctgggcaatttgttgaaccgcactgtagcgatggtagacaaatat
tttgaaggtaaggttccagcttatgaagcgaatgtaacagcattcgacggggctttggag
gaaatggccacagcgacttacagtaaagtagaagaagcgatggaaaacatggagttttcc
gtggcgctcacggtgatcagtcaatttattagccgcagcaacaagtatattgacgaaaca
caaccatggaacctggccaaggatgaggataaacgttgtgagctggcatctgttatggtg
catttggtagaaagcttgcgcatcgcgtccattttgctccaaccgttcttgacccgcgct
ccgtataaaatttgggatcagctgggcgtcaaggaaggtgaattgacgacatgggatagc
ggtaagcagtttggtcgtattccggaaggaacgcaactgatcaaaggcaatcctatcttc
ccacgtctggattcagagcaagaggttgccttcatcgtggaagcgatgacggggggcaag
aagccggaggaagctaccgcgcaggttcaaccgcagaatgcgactgaggcgggccaggaa
gccccagaggcgaaggaagagattggtattgaggactttgccaaggtagaactgcgcgtc
gctcaggttatcgcctgtgagcctgtgaagaaggccgataagctgttgaagctccaactt
gatcttggctatgagcagcgtcaggtggtatcgggcattgccaagttttacacgccggag
gatatggttggacgcaaggtgatttgtgtgaccaatcttaagcctgtgaaactgcgtggg
gagctatcacaagggatgattttggcagcatcgcacggagatcagcttacgctggctaca
gtaccggaaagcatgcctaacggcgcgatcgtaaaataa

DBGET integrated database retrieval system