KEGG   Paenibacillus terrae: HPL003_25415Help
Entry
HPL003_25415      CDS       T01668                                 

Gene name
glyS
Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
pta  Paenibacillus terrae
Pathway
pta00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPL003_25415 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pta01007]
    HPL003_25415 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_25415 (glyS)
Enzymes [BR:pta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     HPL003_25415 (glyS)
Amino acid related enzymes [BR:pta01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   HPL003_25415 (glyS)
Transfer RNA biogenesis [BR:pta03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HPL003_25415 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AET61799
UniProt: G7VQ89
LinkDB All DBs
Position
complement(5513364..5515439)
Genome map
AA seq 691 aa AA seqDB search
MSKDLLFEIGLEEVPARFIPAAIQQLKERMTAWLDSSRIAHGDVEAYATPRRLAVLVKEV
AEKQEDINEEVKGPSRKIALDEAGNWSKAALGFARSQGVDPEQFTFKELGGVEYIYATKS
SIGVPTTEVLSEGLLHILHAMTFPKFMRWASYDFKFVRPIRWLIALFGNDIVNLEIAGVQ
SGNVTRGHRFLGQDTVVESPADYVEALRKQHVIVDIAERQSIIVKQIEALAAEKDWTIAV
KDDLLEEVLYLVETPTVLFGGFDPAFLNIPKDVLITSMREHQRYFPVLDRAGELLPYFVT
VRNGGSQSLDVIAKGNEKVLRARLSDAKFFYEEDQRLEIKDALSKLESIVFHEELGTVGD
KVRRIRRIADALAEKLRVSPDTQESVSRSADICKFDLVTQMVYEFPELQGVMGEDYARKA
GEKEEVARAVFEHYQPRFAGETVPSTNAGAIVSIADKIDTITGCFSIGIIPTGSQDPYAL
RRQAAGIVQILLDRNLSTTLSDVFNIALDVHDNLGNMKRSADEIRKELHEFFGLRVKKLL
SETLRYDVVDAVLAAGFDDVASVVDRGAALMNAVQTGDTFKTTVESFNRVGNLAAKAVHA
SVNTGEFTEQGEKALYETWYGVYESYTTALQEGDATRALALASSITPAVTAFFDSVMVMA
EDDAIRNNRLALLAAIDRELKRFADFSKLVG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggatttgctgtttgaaattggtttggaagaagtgcccgcccgctttatccct
gctgcgattcagcagttgaaggagcgtatgactgcatggctggacagctcacgtattgct
catggtgatgtagaagcttatgctacccctcgtcgtctggcggtgttggttaaggaggta
gcagaaaagcaggaagatattaacgaagaagtcaaaggtccttcccgcaaaatcgcactt
gacgaagctggcaattggagcaaggctgctctcggctttgcccgcagccaaggtgttgat
cctgaacagtttacattcaaggagcttggaggcgtggagtatatttacgcgaccaagagc
agtataggtgtaccgacaacggaagtgctgtccgaaggcttattacacattttgcatgcc
atgactttccctaaatttatgcgctgggccagctatgactttaagtttgttcgtccaatc
cgctggttgatcgccttgtttggcaacgacattgttaacctagaaattgccggggttcaa
tctgggaatgtgacaagaggacatcgttttctcgggcaggatactgttgtggaaagtccg
gcagactatgttgaggcacttcgtaaacagcatgtcattgtggatattgcggaacgccag
tccattatcgtgaagcagattgaagcattggcagccgaaaaagactggacgatcgcggtt
aaggatgatctgctggaagaagtgctgtatctggtcgaaacgccgacggtactgtttgga
ggttttgatccagcgttcctcaacattccgaaggatgtgctgattacttccatgcgtgag
catcaacgctatttcccagtgctggatcgcgcgggagagctgctgccatactttgttaca
gtacgtaacggtggaagccaatcgctggatgtcattgccaaagggaacgaaaaagtattg
cgcgcacggctatctgatgccaaattcttttatgaagaagatcagagactggaaatcaag
gatgcactctccaagctggaaagtatcgttttccacgaggaattgggtacggttggagac
aaggtacggcggattcgccgcattgccgatgctttagctgagaagctgcgggtttccccc
gatacacaggagtcggttagccggtcggcggatatttgtaaattcgacttggtaacgcaa
atggtatatgagtttccggaactgcaaggtgttatgggtgaggactatgcccgtaaggct
ggagagaaggaagaagtggcgagagcggtgtttgagcactatcagccgcgttttgccgga
gaaacggttccttctacgaacgcaggagctattgtcagcatcgctgacaaaattgacacc
atcactggctgcttctccatcggtattattccgacaggctcgcaggacccttatgcgctt
cgtcgccaagccgcaggtattgtgcagattttactggatcgtaatctttcgacaactttg
tctgatgtgttcaatattgcacttgacgtacacgacaaccttggaaatatgaaacgttct
gccgatgaaattcgtaaagagttacatgaattcttcggtttacgtgtgaaaaaactgttg
tccgagacgcttcgttatgacgtcgtagacgccgtgcttgctgccggatttgatgatgtt
gcttctgtcgttgatcgcggagcagctctgatgaatgcggtacaaacgggagataccttt
aagacaacagtagagtcgtttaaccgtgtaggtaatttggctgcaaaagctgttcatgca
tcagttaatacgggtgaatttacggagcagggtgaaaaagcgctctatgaaacatggtac
ggcgtttatgaatcttatactacagcattgcaggaaggcgatgctacgcgagctttagca
cttgcctcgtctattactcctgcggtgacagcgttctttgattccgtaatggttatggct
gaggatgatgcgatccgtaataaccgattggcattgctggccgctattgatagagagctg
aagcgttttgccgatttttccaagctcgtgggctaa

KEGG   Paenibacillus terrae: HPL003_25420Help
Entry
HPL003_25420      CDS       T01668                                 

Gene name
glyQ
Definition
(GenBank) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
pta  Paenibacillus terrae
Pathway
pta00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPL003_25420 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pta01007]
    HPL003_25420 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_25420 (glyQ)
Enzymes [BR:pta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     HPL003_25420 (glyQ)
Amino acid related enzymes [BR:pta01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   HPL003_25420 (glyQ)
Transfer RNA biogenesis [BR:pta03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HPL003_25420 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AET61800
UniProt: G7VQ90
LinkDB All DBs
Position
complement(5515432..5516319)
Genome map
AA seq 295 aa AA seqDB search
MNFQQMILTLQQFWAEHNCIIVQPYDTEKGAGTMNPMTYLRSIGPEPWNVAYVEPSRRPA
DGRYGENPNRLYQHHQFQVVLKPSPDNIQELYLESLSRLGINPLEHDIRFVEDNWEAPTL
GAWGLGWEVWLDGMEITQFTYFQQVGGIDASPVAVEITYGMERLASYIQDKENVFDLEWV
NGITYGDVFHQPEFEHSKYTFEVSDVKMLFTLFNMYEEEANKAMAQHLVFPAYDYVLKCS
HAFNLLDARGAISVTERTGFIMRVRNLARQVAATYLEEREKLGFPLLKKGGAAHV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaattttcagcagatgattttgacactgcaacaattttgggctgagcacaactgtatt
attgtacagccgtatgacacggaaaaaggggcaggtacaatgaacccgatgacgtatttg
cgttcgattggacctgagccgtggaacgtagcttatgtcgagccgtcccgccgccccgca
gatggacgttatggagagaacccaaatcgtctgtatcagcatcaccagtttcaggttgtt
ttgaagccatcgcctgataacattcaggaattgtatctggagagcttgagccgtcttggc
attaatcctctggagcatgatattcgcttcgttgaagataactgggaagcgccaacgctg
ggagcgtggggattaggttgggaagtatggctggatggtatggaaattacccaattcacg
tattttcagcaagtgggcggtatcgatgccagtccggttgcggttgaaattacgtatggt
atggagcgtcttgcttcctacattcaggacaaggagaacgtgttcgatcttgagtgggtt
aatggcatcacgtatggtgatgttttccaccagcctgaatttgagcattctaaatatacg
tttgaagtatctgatgtcaaaatgcttttcactctttttaatatgtatgaagaagaagcg
aataaagccatggcgcagcaccttgtatttccagcctacgattatgtgctgaaatgctct
catgcgttcaacttgctggatgcccgcggggcaatcagtgtaacggaacggaccggattt
attatgcgtgtgcggaatttggcccgtcaggtggctgcaacttatctggaggaacgcgag
aagctcggcttcccgctgttgaagaaaggaggtgcggcacatgtctaa

DBGET integrated database retrieval system