KEGG   Paenibacillus terrae: HPL003_27980Help
Entry
HPL003_27980      CDS       T01668                                 

Definition
(GenBank) S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Queuosine biosynthesis protein queA)
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
pta  Paenibacillus terrae
Brite
KEGG Orthology (KO) [BR:pta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_27980
Enzymes [BR:pta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     HPL003_27980
Transfer RNA biogenesis [BR:pta03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    HPL003_27980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Queuosine_synth
Motif
Other DBs
NCBI-ProteinID: AET62306
UniProt: G7VTC6
LinkDB All DBs
Position
complement(6076186..6077214)
Genome map
AA seq 342 aa AA seqDB search
MNVNDYDFELPETLIAQTPLLDRSASRLLTLSKGSGEVGHHTFSDIVQYLQPGDTLVLND
TRVIPARLFGIKEDTGAKAEVLLLKQLEGDRWEALVKPGKKLKKGAVIVFGDELKAVIEE
EGDMGGRVLSFSYEGIFQEILDRLGQMPLPPYIKEQLDDRERYQTVYARHEGSAAAPTAG
LHFTEELLDRIREKGVSIAFVTLHVGLGTFRPMSVDTIEEHVMHEEYYSLSQETADVLNE
TKARGGRVVAVGTTSCRTLETVGNTFGDGLLQASSGWTQIFIYPGYEFRVVDAMITNFHL
PKSTLVMLVSALAGRENIMHAYQEAIDREYRFFSFGDAMFIY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaacgattacgattttgaattacctgaaacattaattgcacagacgcctttg
cttgatcgaagtgcttccagattgctgacgttgagcaaggggagcggtgaagtgggtcat
catacattttcagatattgtgcagtatcttcaaccgggcgatacgctggtgctgaatgat
acgcgagtgattcctgcacgcttgtttggtatcaaggaagatacgggggctaaggccgag
gtgttactgctcaaacaactggagggtgaccgatgggaagcattggtaaaacccggcaag
aagttgaaaaagggcgcggtcatcgttttcggtgatgagctgaaggcggtcattgaggaa
gaaggcgatatgggcggaagagtgctctccttctcatatgaaggtatttttcaggagata
ttggatcgtcttgggcaaatgccgcttccaccgtatatcaaggagcaactggatgaccgt
gagcgttatcagacggtttatgcccggcatgaaggctcagctgcggctccaaccgcagga
ttacattttacagaggaattgctggaccgaattagagaaaagggtgtttccattgccttt
gtcacccttcacgtcggtttaggaacgttcagacccatgtctgtggatacgattgaagag
catgtgatgcatgaagaatattactcgttgtcacaggaaacggcagatgtgctgaatgaa
accaaagcgcgtggcggaagagtcgtggcagtggggacaaccagttgtcggacgctggag
actgtgggcaatacattcggtgacggactattgcaggccagcagcggctggacgcagatt
tttatttatccaggttatgaattccgtgtggtagatgcgatgattacgaattttcatttg
cctaaatccacattggttatgctggtcagcgcactggcgggcagggagaatattatgcat
gcttaccaggaggcgattgaccgggaatatcggtttttcagctttggggacgcaatgttc
atttattaa

DBGET integrated database retrieval system