KEGG   Parageobacillus toebii NBRC 107807: DER53_06845Help
Entry
DER53_06845       CDS       T06505                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ptb  Parageobacillus toebii NBRC 107807
Brite
KEGG Orthology (KO) [BR:ptb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DER53_06845 (ahpF)
Enzymes [BR:ptb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DER53_06845 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C NAD_binding_7 Thi4 FAD_binding_3 Glutaredoxin NAD_binding_8 Thioredoxin_4 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: QIQ32564
LinkDB All DBs
Position
1338918..1340447
Genome map
AA seq 509 aa AA seqDB search
MILDAEIKAQLAQYLQLMENDIVLKVSAGDDQVSRDMLALVDELAAMSPKIKVEKTQLQR
TPSFSVNRIGEDTGITFAGVPLGHEFTSLVLALLQVSGRPPKVDQNVIDRIKSIKGTYHF
ETYVSLTCHNCPEVVQALNLMSVLNTGISHTMIDGAAFKDEAERKGIMAVPTVFLNGELF
GSGRMSLEEILAKMGNTLDASHFAEKEPFDVLVVGGGPAGATAAIYAARKGVRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASLEEHVKQYDIDIMNLQRAKRLEKKDLIEIELE
NGAVLKSKTVIIATGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGI
EAAIDLAGIAKHVTVLEFMPELKADAVLQERLYSLPNVTVLKNVQTKEITGTDKVNGITY
IDRATGEEHHIELQGVFVQIGLVPNTDWLDGTIERNRFGEIIVDKHGATNIPGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatattggatgccgagataaaagcgcaattagcccaatatctacaattgatggaaaat
gacattgttctaaaagtgagcgcgggagacgatcaagtttcccgcgacatgcttgcttta
gtcgatgaattggccgcaatgtcaccaaaaattaaagtagagaaaacgcagttgcaaaga
acgccaagctttagtgttaatcgtatcggcgaagatactggtataacattcgctggtgtt
cctttagggcatgagtttacctccttagtgcttgctctgcttcaagtaagcggaagaccg
ccaaaggttgatcagaacgtgattgaccgaattaaaagcataaaaggcacctatcacttc
gaaacttacgtgagtttgacatgccataattgtcctgaggtggttcaagcgttgaacttg
atgagcgtcctgaacacgggcatttcgcatacgatgatcgatggcgcagcctttaaggac
gaagcggaaagaaaaggaattatggcagttccaacagtattcctaaatggagagctcttt
ggtagcggccggatgtcgttggaggaaattttggcgaagatggggaatactttggacgca
tcacatttcgctgaaaaagaaccatttgatgtactggttgtcggtgggggaccagccgga
gcaactgcagcgatttatgcggcgcgtaaaggcgttcgtacaggcattgttgcggaacgt
tttggcggtcaaatattggatacattaggcattgaaaactttatcagtgtgaaatatacg
gaaggccctaagcttgcagcaagccttgaagagcatgtcaaacagtacgatattgatatt
atgaatttacagcgtgccaaacgcttggaaaagaaagatcttattgaaatcgagcttgaa
aatggcgccgtgttaaaaagcaagacggttattatcgcaacaggggctcgctggcgcaac
cttggcgtaccaggcgaggcggagtttaagaacaaaggggtcgcatactgcccacattgc
gatggtccgttgtttgaaggaaaacatgttgcggtcattggtggcggcaattccggtatt
gaggcagccattgatcttgcaggcattgcaaagcatgtcaccgttcttgagtttatgccg
gagctgaaagccgatgctgttttacaagagcgcctttatagcctgcctaacgtaacggtt
ttaaagaacgtgcaaacaaaagaaattaccggtacggacaaagtaaatggcatcacttat
atcgaccgggcgaccggagaggaacatcatattgaattgcaaggggtatttgttcagatc
ggcttagtgccgaatacggactggttagatggaacgattgaacgcaatcgcttcggcgaa
attattgtcgataagcatggcgctacgaacatccctggagtgtttgctgcaggtgactgc
acggatagcgcgtataagcagatcattatttcaatggggtcaggcgctaccgcagcctta
agtgcatttgattaccttattcgaaattaa

DBGET integrated database retrieval system