KEGG   Candidatus Phycorickettsia trachydisci: phytr_4720Help
Entry
phytr_4720        CDS       T05372                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ptc  Candidatus Phycorickettsia trachydisci
Pathway
ptc00970  Aminoacyl-tRNA biosynthesis
ptc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    phytr_4720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptc03029]
    phytr_4720
Enzymes [BR:ptc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     phytr_4720
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     phytr_4720
Mitochondrial biogenesis [BR:ptc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    phytr_4720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: AVP87421
UniProt: A0A2P1P831
LinkDB All DBs
Position
complement(534345..535823)
Genome map
AA seq 492 aa AA seqDB search
MALTLILYQKVFSMSLGNGWEYVIGLEVHAQVKSNSKLFSSSPATFGQTPNSCVALFDAA
LPGMLPVLNEHCVRQAIKTGLAINATINKVSAFDRKNYFYPDLPSGYQISQFYHPIVSNG
YLDIEIGDQVKRIRIERIHLEKDAGKSLHDQDPTKTFIDLNRAGIGLMEIVTAPDLSSPE
EAAEYLKKLRSILRYLGTCDGDMEKGSMRCDANVSVRKKGAPLGTRCEIKNLNSIKNIVS
ALEYEAERQIEIIEAGGVIEQETRLFDAEVGETRLMRSKEDALDYRYFPDPDLPPLVLEQ
DYIDQVKKEMIELPDAKKQRYIDSYGLSKYDAGVLSADKAVADYFEIVAKNSDYKLAANW
IMGELFSYLNDNDLEIVNAPIKPEHLAELINLISDKTISGKIAKDIFKDMTTSNMTPKEI
VKAKNLGQISDPNQLAEIIDEVVKNNPETVQEYLSGKTRLFGFLVGQVIKASGNKADPVL
VNKLLQEKLQKL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtggcattaacattaattttataccaaaaggtttttagtatgagtttaggtaatggttgg
gaatatgttataggtcttgaggttcatgctcaagttaaatctaattctaaattattttct
tcatctcctgcaacgtttggtcaaactcctaattcttgcgtagctttgtttgatgcggct
cttcctggcatgcttccagtgctaaatgagcattgcgtgaggcaagctattaagactggt
cttgcgataaatgcaactatcaataaggtatctgcttttgaccgtaaaaattacttttat
ccagacttgccgagcggttatcaaatttctcagttttaccatcctatagtttctaatgga
tatctagatatagaaattggtgatcaggttaaaagaattagaattgagagaatacactta
gaaaaagatgctggaaaaagcttacatgaccaagatcctaccaagacttttattgaccta
aatagagccggtattggcttaatggaaatagtaacagctcctgatttgagctcaccagaa
gaagctgctgagtacttgaaaaaattgcgtagcattttaaggtatttaggtacttgtgat
ggtgatatggaaaagggatctatgcgctgcgatgctaacgtatcggttagaaaaaaaggg
gccccactaggaactaggtgtgagataaaaaaccttaattccattaaaaacatagtaagt
gctcttgagtacgaagcagaaagacaaatagaaatcattgaagctggaggtgtgattgag
caagaaaccaggctttttgatgctgaagttggagaaactcgcttaatgagatcaaaagaa
gatgctttagattatagatatttcccagatcctgatttaccaccattggttttagagcaa
gactatattgatcaagtcaaaaaagaaatgatagaattgcccgacgctaagaagcaaagg
tatattgattcttatggtttaagcaagtacgatgctggagttttatctgctgataaggct
gttgctgactattttgagatagtcgctaaaaattctgattataagcttgctgctaactgg
attatgggagaattatttagctatctcaatgataacgaccttgaaatcgttaatgctcct
attaagccagagcatttagctgagttgattaatctaattagtgataagactatctcgggt
aagattgcaaaagatatcttcaaagatatgacgacaagtaatatgactcctaaagagata
gtgaaagctaagaatcttgggcaaatttctgacccgaatcaacttgctgaaattatagat
gaagtggtaaaaaataatcccgagaccgtgcaagaatatttatcgggtaaaacaagacta
ttcggctttttggtaggtcaggtgattaaggcaagtggtaataaggccgaccctgtgctt
gtaaataagttgctacaagaaaagcttcaaaaattatga

DBGET integrated database retrieval system