KEGG   Candidatus Phycorickettsia trachydisci: phytr_8250Help
Entry
phytr_8250        CDS       T05372                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ptc  Candidatus Phycorickettsia trachydisci
Pathway
ptc00061  Fatty acid biosynthesis
ptc00780  Biotin metabolism
ptc01100  Metabolic pathways
ptc01212  Fatty acid metabolism
Module
ptc_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ptc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    phytr_8250
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    phytr_8250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ptc01004]
    phytr_8250
Enzymes [BR:ptc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     phytr_8250
Lipid biosynthesis proteins [BR:ptc01004]
 Fatty acid synthase
  Component type
   phytr_8250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT AfsA PS-DH
Motif
Other DBs
NCBI-ProteinID: AVP87757
UniProt: A0A2P1P922
LinkDB All DBs
Position
complement(912127..912570)
Genome map
AA seq 147 aa AA seqDB search
MENIDITEILKVLPHRYPFVLIDKITSLEKSKNIVAIKNITINEQFFQGHFPGKPTMPGV
LIIEAMAQAAAMLVAKSLDLSAENSIPYLAGIDKARFRRVVVPGDVLTIDVSIVQKKGSI
WIAAGSAKVGEELAAESSLMAAIKTNS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatattgatattactgaaatattaaaggttttgcctcacaggtatccttttgtt
ttgatagataaaattactagtttagaaaaatcaaagaacatagtagctattaagaacatc
acaattaatgagcaattttttcagggacattttcccggtaaaccaactatgcccggggtt
cttataatcgaagcaatggcgcaagctgctgcaatgctagttgctaaaagcttggatctt
tcggccgaaaattcaattccttatcttgcaggtattgataaggcgcgttttagacgtgtt
gttgttcctggggatgtgttaactattgatgttagcattgtgcaaaaaaaggggagcatt
tggattgcagctggcagcgctaaagttggagaggagttggcagcagagagttctttgatg
gctgcgattaagactaattcttaa

DBGET integrated database retrieval system