KEGG   Candidatus Phycorickettsia trachydisci: phytr_9570Help
Entry
phytr_9570        CDS       T05372                                 

Definition
(GenBank) malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
ptc  Candidatus Phycorickettsia trachydisci
Pathway
ptc00620  Pyruvate metabolism
ptc01100  Metabolic pathways
ptc01120  Microbial metabolism in diverse environments
ptc01200  Carbon metabolism
Module
ptc_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:ptc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    phytr_9570
Enzymes [BR:ptc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     phytr_9570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AVP87885
UniProt: A0A2P1P9F0
LinkDB All DBs
Position
1075988..1078225
Genome map
AA seq 745 aa AA seqDB search
MTQDLKTRALFYHQHKTPGKIGISPTKPLVTQEDLALAYSPGVAEPVKEIYKDVNNIYKY
TARGNMVAVISNGTAILGLGNLGAAAAKPVMEGKAVLFKRFADVDAIDLEVDTSDPDEFI
SAVKHLGYSFGGINLEDIKAPECFYIEDALRKALDIPVFHDDQHGTAIIVLAGLINAALI
AGKELKNLKIIVNGAGAAAIACLDLLTSFEVNKDNVVLCDTLGVVHKGRSKGMNQWKERY
ATNLSARSLEEAIKGADVFLGLSVKGALSPEMVEKMAPNPIIFALANPDPEITPDQAHSV
RNDAIVATGRSDYPNQVNNLMGFPYIFRGALDVRAREINIEMKIAAALTLAKMAREIVPT
QVSKAMKGKKMVFGPEYIIPSPFDPRLIIDLPMAVAKAAIETKVAGITDLDLAKYKRDLA
SRLNPSANYLNTVLSKISKNKRIILADGEDIETIKAAFKIRDRLGCTPIIVGRTKILQPL
LNEVGKNNIGGIELTNAVLSKDTEQYILFLYEKLQRLGYTKQDCANLVKNDKNIFSACML
AFGGADSLIMGNTRDYDECFALLSKIVGTSSNIPIFEYYNILDSDNTLMVVDPSPTWSEA
SANDISQIVLKSAKIMRNLGLVPSVALISYQNFADCKYNARTQEVLSILDSMKVDFEYDG
NMTPDVALNPSLMKLYPFCKFSNPANILIMPNSEVSAISLKMLSQLLGTKTHVMGPILSG
FKKNIQLHHFTASEIFDMAVISLME
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggatttaaaaactcgtgctcttttttatcatcaacataaaactccaggcaag
ataggaatcagtcctacaaaacctttagtgacacaagaagacttagcgcttgcttattct
cctggagtagctgagcctgttaaggaaatttataaagatgtaaacaatatatataaatac
acagctcgtggtaatatggtggctgttatttccaatggaactgcaatcttaggtttgggt
aatctgggagctgctgctgcaaaacctgtaatggaaggcaaagcagtattgtttaagagg
tttgctgacgttgatgcaatagatttagaggttgatacaagtgatcctgatgagtttatt
tctgcagttaagcatctaggatatagctttggtgggattaatttagaagatataaaagcg
ccagaatgcttttatatagaagacgctttgcgcaaggctttagatatacccgtattccat
gatgaccaacatggaactgcaattatcgtattggcgggtcttattaatgcggcacttatt
gcgggcaaagagctgaaaaatttaaagataatagtaaatggtgcaggagctgctgcgata
gcttgcctagatttgctaacatcatttgaagtgaataaagataatgttgttttatgtgat
acattgggggtagtgcataagggaagaagcaaggggatgaatcagtggaaggaaaggtat
gcaactaatctaagtgcgcgcagtttagaagaggctataaaaggagctgatgtgtttctt
ggattatcggtcaaaggtgctctatcccctgaaatggtggaaaaaatggcaccaaatcct
attatttttgctcttgcaaaccctgatccagaaataactccagatcaggctcatagcgtt
agaaatgatgcgatagttgcaactggtaggtctgactatccaaatcaggttaacaacctt
atgggttttccttatatctttagaggagccctagatgtgcgtgcaagagagattaatatc
gagatgaaaattgcggcagcacttactcttgccaaaatggcacgtgaaattgtaccaact
caggtttcaaaagcaatgaagggaaaaaaaatggtatttggtcctgaatatattattcca
tcgccttttgatcctcgattaattattgatctgccaatggctgtggctaaagctgcaata
gagaccaaggtagctggtatcacagatttagatcttgcgaaatataaaagagatctagca
agccgccttaatccatctgctaactatcttaatactgtactttccaaaatctctaagaat
aaacgaataatcttagcagatggtgaggacattgaaactattaaggcggcattcaaaatt
agagatagattgggatgtactcctattattgtcggtagaacgaaaatactacaacctctc
ttgaatgaagttggtaagaataatataggcggtattgagctgacaaatgctgtgctaagc
aaagatacagagcaatatatcttattcttatatgagaagctgcaaagacttggttacacc
aagcaagactgtgcaaatctagttaaaaatgataaaaatattttctctgcttgcatgctt
gcatttggaggggcggatagtttgattatgggcaatacaagggattatgatgaatgcttt
gcgctgttgagtaagattgttggcacaagttctaatattccgatttttgagtattataat
atcttagattcagataatactttgatggtagttgatccatctccaacgtggtcagaggct
tcagctaatgatatttctcaaatagtcctaaagtctgcaaaaattatgcgaaacttaggt
ctagttccaagcgttgctttaatttcctatcagaattttgcagattgcaaatataacgca
agaacccaggaggtcttaagtattttagactctatgaaggttgattttgagtatgatgga
aatatgacgcctgatgttgcattaaacccatcgttaatgaaactatatccattctgtaag
ttctctaatcctgcaaatatactcataatgccaaactctgaggtgtcagcaatttcgctc
aaaatgttatctcagttgcttggaactaagacgcatgttatgggtccaatacttagtggc
tttaagaagaatattcaattacaccattttaccgcaagtgaaatttttgacatggctgtt
atatccttaatggagtaa

DBGET integrated database retrieval system