KEGG   Pseudoalteromonas tetraodonis: PTET_a0324Help
Entry
PTET_a0324        CDS       T05282                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ptd  Pseudoalteromonas tetraodonis
Pathway
ptd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ptd01100  Metabolic pathways
ptd01110  Biosynthesis of secondary metabolites
ptd01130  Biosynthesis of antibiotics
ptd01230  Biosynthesis of amino acids
Module
ptd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTET_a0324 (aroK)
Enzymes [BR:ptd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PTET_a0324 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_33 Thymidylate_kin Cytidylate_kin dNK AAA_18
Motif
Other DBs
NCBI-ProteinID: ATD01905
UniProt: A0A290TBV5
LinkDB All DBs
Position
I:334044..334526
Genome map
AA seq 160 aa AA seqDB search
MGAGKSTIGRHIADQLHLEFVDSDQEIERRTGADIAWVFDLEGEEGFRLREESVIGDLTE
MQGIVLATGGGSVMSKEVRNKLSARGIVVYLETPIEKQVARTQRDKRRPLLQTEEAPRDV
LERLAEEREPLYKEVADFVVRTDEQSAKVVANQIIEKLDF
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggggctggcaaaagcacgattggtcgtcacattgctgaccaattacaccttgaattt
gttgattctgatcaagaaatcgaacgtcgcacgggcgcagatattgcctgggtattcgat
cttgaaggtgaagaaggctttagacttcgtgaagaatctgttattggtgacttaaccgaa
atgcaaggtattgtacttgcaaccggtggtggctcagtaatgagtaaagaagttcgaaac
aagctttcggctcgcggtattgttgtatacttagagacaccgattgaaaagcaagttgca
cgtacgcaacgcgacaagcgtcgcccattactgcaaacagaagaagcacctcgtgatgta
cttgagcgcttagcagaagagcgtgaaccattatataaagaagtagctgattttgttgta
cgcactgatgagcagagcgcgaaagttgttgctaaccaaatcatcgagaaattggatttt
taa

DBGET integrated database retrieval system