KEGG   Pseudoalteromonas tetraodonis: PTET_a0892Help
Entry
PTET_a0892        CDS       T05282                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ptd  Pseudoalteromonas tetraodonis
Pathway
ptd00250  Alanine, aspartate and glutamate metabolism
ptd00410  beta-Alanine metabolism
ptd00430  Taurine and hypotaurine metabolism
ptd00650  Butanoate metabolism
ptd01100  Metabolic pathways
ptd01110  Biosynthesis of secondary metabolites
ptd01120  Microbial metabolism in diverse environments
ptd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PTET_a0892 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTET_a0892 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTET_a0892 (gadB)
   00430 Taurine and hypotaurine metabolism
    PTET_a0892 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PTET_a0892 (gadB)
Enzymes [BR:ptd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PTET_a0892 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATD02404
UniProt: A0A290TDE2
LinkDB All DBs
Position
I:870065..871690
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAAIPEEPTFVSCYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYSQSDGFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKADGNFKGIAAQGLVAGMLHYGHKGLAVLISERGHYSLGKSVDLLGIGRENL
IGIKTSADNKVDVSAMREKALELEAQGIKVMAIVGVAGTTETGNIDPLEDMANLAQEINC
HFHVDAAWGGATLLSNTHRHLLKGIEHADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKARYFADLI
KADEDFELISEPELCLLTYRYVPKQIKHAIAQADAQTRLDIFAALNRFTASMQKRQRESG
RSFVSRTRLTPVQYDNQPTVVFRVVLANPLTSGVILKEILEEQKELAQTDPVFKKYLRKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaaacggatattcaccgtt
ccagaggcgccagactcaactttgagcaaaatagagcttgaaatttcgagtaatttagca
ggtttcttaaacgaaaatatcgcggcaattgaaaaaccattacatgaaatagaaaaagat
tttcaatcggcggcaatccctgaagaaccgacgtttgtgtcttgctatgctcaagatatt
atggagcagctggttgctcattctgttcataccgcagcgccaagctttattggccatatg
acatcggctctgcctcattttttactaccgttatcgaaattaatggttgggttaaatcaa
aacctagtaaaaattgaaacctcgaaagcgtttaccccattagaacgtcaagttttaggg
atgatgcatcatttagcttatagccaaagtgatggtttttattctaaatggatgcacagt
gcaaaaacttcgttaggggcattttgctctggcggcaccgtggcaaatattactgcactt
tggatagctcgaaaccgcttattaaaagcggatggcaattttaaaggcattgctgcacaa
ggtttagttgcaggaatgcttcactatggtcacaaagggctggcagttttaatttctgaa
cgaggtcattattcgcttggtaaatcggttgatttattaggtattggtcgtgaaaattta
attggtatcaaaacttctgccgataacaaagtcgatgttagtgcaatgcgagaaaaagcg
ttagagcttgaagcacaaggcattaaagtgatggcaattgttggggtcgcaggaaccact
gaaaccggtaatattgacccacttgaagatatggctaatttagcacaagagattaattgt
cattttcatgttgatgcagcgtggggtggagctactttactgtctaatacccataggcat
ttattaaaaggtattgagcatgcagattcaatcaccattgatgcgcataagcaaatgtat
gtgccgatgggggccggtttagtcttatttaaagaccctgctgcaactgatgccatcgag
catcatgctgaatatattttacgtaaaggctctaaagatttaggcagccatacgcttgag
ggaagtcgccctgggatggcgatgttagtgcatgcttgcttacgtgttattggtcgtaaa
ggctatgaaatgcttatcgatcgcagtattaaaaaagcgcgttattttgctgatttaata
aaagccgatgaagactttgagttaatatcagagccagaactttgcttactgacctatcgc
tatgtaccaaaacaaattaaacacgcgatagcccaagctgatgcacaaacccgtttagac
atttttgccgcgcttaatcgttttactgccagcatgcaaaaacgccaacgtgaatcgggt
cgctcatttgtatcgcgtacgcgtttaacgccagttcaatatgataaccaaccaaccgtg
gtatttagagtggtactggcgaacccgcttacctcaggtgttatattaaaagagatatta
gaagagcagaaagaactggcacaaactgatccggtgtttaaaaagtatttacgaaaatat
atgtaa

DBGET integrated database retrieval system