KEGG   Pseudoalteromonas tetraodonis: PTET_a1599Help
Entry
PTET_a1599        CDS       T05282                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ptd  Pseudoalteromonas tetraodonis
Pathway
ptd00500  Starch and sucrose metabolism
ptd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTET_a1599
Enzymes [BR:ptd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PTET_a1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Asp_protease
Motif
Other DBs
NCBI-ProteinID: ATD03030
UniProt: A0A290TFQ4
LinkDB All DBs
Position
I:1561318..1563723
Genome map
AA seq 801 aa AA seqDB search
MKKYNLITATILAAGLVGCGVQNTQTSAVAQTSVSAPGAPGEAPFWAYAGKTGIGTSFEQ
YQNGHYSDEAPTGKVSKVWFSIAKGMITETMFGLIHQAQIKDMQFVVVGKDFTVTEADDL
DVTIDYLYKDDKGRPLSLAYKVVSKDKQGRFSLEKHIFTDPDGQSLFVRSIFNTQLDGVK
AYVTVNPYINNNGLDDFAKTIEQGLVAWQGDNYLSLQGAQPFKQTSVGFTGVSDGLSQLK
TTQQLTRVYKTTGEQSGNVSLLAELGEIGKNSQFDLTLSFGNNQQSSFKQGQATLAKGYQ
AVLDNYNGKGEALGWQDYLQSLAPLNNMSEQTADNGKLLYTSAMVLKAQEDKTHAGALIA
SLSNPWGETVSAKTGSTGYKAVWVRDFYQVAMAFMALGDTATAKTAFEYLEKVQVNSKTP
GNKGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLHQADVLSGAELTDWYTRMLKP
AADLLVDGGRAKILWNDMQITPPATQQERWEEQEGYSPSTTAAVIAGLITAADIAKMAGD
EVNAKRYLATAKSYNADIESMMFTTAGNLESNASDGEYFIRIGQDKDANSNTKINANNGR
DGFNKKQILDGGFLELVRYGVRDALAPSIVKTLPEYDDETLTDNLQVKYSFEFTDGSGTF
AGYRRYGNDGYGEDEVTGANYAQGGKNSPGQRGRVWPFFTGERGHYEIAAANANNTLDAT
KQQAIKNSYVKGLEQFANEGMMLPEQVWDGVGVNKAGYTLGEGTNSATPLAWTHAEYVKL
VRSLSDKQVWDHYPVVTKALK
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataatctaattaccgcgacaatattggccgcaggccttgtaggttgtggt
gtgcaaaatacgcaaaccagtgcagtagcgcaaacatcagtgagtgcgccaggcgcacca
ggcgaagccccattttgggcatacgcaggcaaaactgggataggcacgtcttttgagcaa
taccaaaatggccattacagtgacgaagcacctacaggtaaagtgtcaaaagtatggttt
tcgattgccaaagggatgatcaccgaaaccatgttcgggcttattcatcaagcgcagatt
aaagacatgcaatttgttgtagtcggaaaagattttacagtcaccgaagctgacgattta
gacgttaccattgattacttatacaaagacgataaaggccgcccgttatcattagcatac
aaagtagtaagcaaagataagcaaggtcgctttagcctcgaaaaacatatatttaccgac
ccagacggtcaaagcttatttgtacgcagtatttttaatacccagcttgacggtgtaaaa
gcatatgtaacagttaacccgtatataaacaacaacggcttagatgactttgcaaaaacc
atcgagcaaggattggtagcgtggcagggcgataattacttgtcattgcaaggtgcacag
ccatttaaacaaacaagtgttggttttacaggtgtgagcgatggtttaagccagcttaaa
acaactcagcagcttacccgagtttataaaactaccggtgaacaatcgggtaatgttagc
ctacttgcagagctgggtgaaattggtaaaaacagccagttcgatttaaccctaagcttt
ggtaacaaccagcaatcaagctttaaacaagggcaagctacgctagccaaaggttaccaa
gctgtgcttgataattacaacggtaaaggcgaagcgcttggttggcaagactacctgcaa
agccttgcaccgctaaacaacatgagcgaacaaaccgctgataacggcaagttactttac
accagtgctatggtgttaaaagcgcaagaagacaaaactcatgctggggcacttattgcc
tctttatctaacccatggggtgaaaccgtatcggcgaaaaccggctctaccggttacaaa
gcggtatgggtgcgcgacttttatcaagttgccatggcatttatggcactaggcgatacc
gcaacagccaaaaccgcatttgaataccttgaaaaagtacaagtaaacagcaaaaccccg
ggcaacaaaggcgacacagggtggtttttacaaaaaacacacgtagatggcgaacttgaa
tgggtaggcgtacagctagaccaaaccgctatgcctattatgctagcgtggaagcttcat
caggcagatgtgttaagtggtgctgagctaactgattggtatacccgcatgttaaaaccg
gccgctgaccttttggtagacggtgggcgcgctaaaatcctatggaacgacatgcaaata
accccacctgcgactcaacaagagcgttgggaagagcaagaagggtattcgccatcaacc
accgctgctgttattgccggtttaattaccgccgctgatattgcaaaaatggcaggtgat
gaggtaaatgctaaacgctaccttgcaacagcaaaaagttacaacgccgatatagaaagc
atgatgtttaccaccgcaggaaatttagaatcaaacgcatcagacggcgagtattttata
cgtattggtcaagacaaagacgccaattcaaatactaaaattaacgccaataatggccgt
gacgggtttaataaaaagcaaattctcgatggtggatttttagagctcgttcgctatggt
gtacgtgatgcactagcgcctagcatagtaaaaacactcccagaatatgatgacgaaacc
ctaaccgataacctacaagttaaatacagctttgagtttactgatggcagcggcacattt
gcaggataccgccgctatggtaacgacgggtacggtgaagatgaagtaactggcgctaac
tatgcgcaaggtggaaaaaatagcccagggcaacgtgggcgagtttggccattttttacc
ggtgaacggggccattatgaaattgccgccgcaaatgctaataataccttagatgcaaca
aaacagcaggctattaaaaatagctatgtaaaagggctagagcaatttgctaacgaaggt
atgatgctaccagaacaagtatgggatggcgtaggcgtaaataaagcaggatacacgtta
ggcgagggtacaaactcggccacaccactggcgtggacgcatgctgaatacgtgaagcta
gtgcgctcactaagcgacaaacaagtatgggatcattatccggtggtaactaaagcacta
aaataa

DBGET integrated database retrieval system