KEGG   Pseudoalteromonas tetraodonis: PTET_a1769Help
Entry
PTET_a1769        CDS       T05282                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ptd  Pseudoalteromonas tetraodonis
Pathway
ptd00061  Fatty acid biosynthesis
ptd01100  Metabolic pathways
ptd01212  Fatty acid metabolism
Module
ptd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PTET_a1769 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ptd01004]
    PTET_a1769 (fabA)
Enzymes [BR:ptd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PTET_a1769 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PTET_a1769 (fabA)
Lipid biosynthesis proteins [BR:ptd01004]
 Fatty acid synthase
  Component type
   PTET_a1769 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: ATD03172
UniProt: A0A1E3WX20
LinkDB All DBs
Position
I:complement(1710493..1711008)
Genome map
AA seq 171 aa AA seqDB search
MEPKNSYTKEDLILCGQGEMFGEGNCRLPSDNMLMMDRIISITDDGGEHGKGQIIAELDI
DPSLWFFDCHFKGDPVMPGCLGLDAMWQLVGFFLGWSGGPGLGRALGVGEVKFTGQILPT
AKKVTYRLDMKRVIKRKLFMGMADGTVEVDGRVIYEAKDLKVGLFQDTSAF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacctaaaaatagctatacaaaagaagatttgatcctttgtggtcaaggtgaaatg
tttggtgaaggaaattgtcgtttaccaagtgacaacatgttaatgatggatcgtatcatc
tctatcaccgatgatggtggtgagcacggtaaaggccaaattattgctgagctagatatt
gaccctagcctttggttttttgactgccactttaaaggcgaccctgtaatgccgggttgt
ttaggcttagatgcaatgtggcaactggttgggtttttcttaggctggtctggtggccca
ggtcttggccgcgcattaggtgtaggtgaagttaaatttactggccaaattctaccaacg
gctaaaaaagtaacttaccgtttagatatgaaacgcgttattaaacgtaagttgtttatg
ggcatggctgatggcactgttgaagtagacggccgcgttatatacgaagcaaaagattta
aaagtgggcttattccaagacactagcgcgttttaa

DBGET integrated database retrieval system