KEGG   Pseudoalteromonas tetraodonis: PTET_a1976
Entry
PTET_a1976        CDS       T05282                                 

Gene name
phoQ
Definition
(GenBank) two-component system, OmpR family, sensor histidine kinase PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
ptd  Pseudoalteromonas tetraodonis
Pathway
ptd01503  Cationic antimicrobial peptide (CAMP) resistance
ptd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PTET_a1976 (phoQ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PTET_a1976 (phoQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptd01001]
    PTET_a1976 (phoQ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ptd02022]
    PTET_a1976 (phoQ)
   01504 Antimicrobial resistance genes [BR:ptd01504]
    PTET_a1976 (phoQ)
Enzymes [BR:ptd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PTET_a1976 (phoQ)
Protein kinases [BR:ptd01001]
 Histidine kinases
  OmpR family
   PTET_a1976 (phoQ)
Two-component system [BR:ptd02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   PTET_a1976 (phoQ)
Antimicrobial resistance genes [BR:ptd01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    PTET_a1976 (phoQ)
SSDB
Motif
Pfam: HATPase_c HATPase_c_5 HATPase_c_3 HATPase_c_2 SHE3
Other DBs
NCBI-ProteinID: ATD03359
UniProt: A0A290TEY6
LinkDB
Position
I:1902219..1903556
AA seq 445 aa
MVAPQISLKIRQGFILVFVLLVALPILFYSIGKAYYASLVDATEKNLEAHLYSLISEVDF
TERGIIMPSSILTPELNNLNSDTYAMIYRDDVPIWHSESAVNVNFVPQYIEPKAGAADFR
RVVYNNTAYWQLSLTVILNNIDQSEQARFILLKRNDALLRLMDGFKQTLVDWMFIMGIAI
AGLMAIGFIWSARPLQRLDKEIKAIESGDIQEIKGLYPVELQTIKADLNLLLESQQRQKE
RYRASLSDLAHALKTPLAVLKSSPLANDADAQEQLDRINVMIEHQLKRAATGASDTWKKQ
TPIKPVIDSILSAMGKVYRDKDIIFNCKVSDKDYFLGDKTDLMELLGNLIDNACKACRSQ
VSIDVSQAKTLSISICDDGPGIQPDKRESLLQRGTRLDTYESGHGVGMAIVSDLVKSYHG
LLTISQSQSLGGAKFILEFNYHEKK
NT seq 1338 nt   +upstreamnt  +downstreamnt
gtggtagcaccgcaaatttcgttaaaaataaggcaaggatttatccttgtctttgtttta
ttagttgccttacctattttgttttactccataggtaaggcgtattacgcgtcacttgtt
gatgccaccgaaaaaaacctcgaagcgcacctgtattcactcatctccgaggttgatttt
accgagcgcggtattatcatgcccagctctatcttaacgcccgaactcaataacctaaac
tcagacacctacgccatgatttaccgtgacgatgtgcctatttggcattctgagtcggcg
gttaacgttaactttgttccccaatatatagagcccaaagccggtgctgcagactttaga
cgcgtggtttataacaacaccgcctattggcagttaagcttaacggtcattcttaataat
attgaccaatcagagcaagcacgatttattttattaaaacgcaacgatgccctactgcgt
ttaatggacgggtttaaacaaaccttagtcgattggatgtttataatggggattgctata
gcagggttaatggctattggttttatttggagtgcaaggccgctgcagcgcctagataaa
gaaataaaagctattgaatcaggcgatattcaagaaattaaaggcttataccccgttgaa
ctacaaacaataaaagccgacctcaacctattgttagagtcgcagcagcgccaaaaagag
cgctaccgcgcctcactcagcgatttagcacatgcacttaaaacgcccctagctgtatta
aaatcaagcccactggccaacgatgccgacgcacaagaacaactcgaccgaattaatgtg
atgatcgagcaccaattaaaacgtgctgctactggggcttccgatacatggaaaaagcaa
acccccatcaaaccggttatcgactctatcttaagtgcaatgggtaaggtttatcgcgat
aaagacatcatatttaattgcaaagtgagtgataaagattactttttaggcgataaaacc
gatttaatggagttattaggtaacttaatagataatgcctgcaaagcctgtcgctcccaa
gtcagtattgacgtttcacaagctaaaacgctcagcattagtatttgtgatgacggcccg
ggtattcaaccagataaacgcgagtcattgcttcaacgcggtacgcgccttgatacttac
gagagtggccatggtgttggcatggcgattgtatctgacttggtgaagtcgtatcacggg
ttgttaactatttctcagtcgcaaagtttgggcggcgcaaaatttattctcgagtttaat
taccatgaaaaaaaataa

DBGET integrated database retrieval system