KEGG   Pseudoalteromonas tetraodonis: PTET_a2388Help
Entry
PTET_a2388        CDS       T05282                                 

Definition
(GenBank) methionine-gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
ptd  Pseudoalteromonas tetraodonis
Pathway
ptd00270  Cysteine and methionine metabolism
ptd00450  Selenocompound metabolism
ptd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PTET_a2388
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PTET_a2388
Enzymes [BR:ptd01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     PTET_a2388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 GDC-P SelA
Motif
Other DBs
NCBI-ProteinID: ATD03727
UniProt: A0A290TGR2
LinkDB All DBs
Position
I:complement(2316310..2317491)
Genome map
AA seq 393 aa AA seqDB search
MSKHHPHTQCIHGPQKANDPHGALTSPLYQTSTFHFENAAQGAARFAGDEPGYIYTRLGN
PTTTELEQKVAQLEGCEAAAATATGMGAVSASVLSFLSQGDHLVASSALYGCTFAFFAHM
LPRWGIEVTFVDMTNEDELRAAIKPNSKMIFAETPINPTMAVIDLALIGDVAKRHNLISV
VDNTFLTPLLQSPKQYGIDIIMHSATKYLNGHGDVVAGIVCGSLEHITHIKMTVLKDIGA
TISPHDAWLINRGLKTLAIRVERHCQSAQTIAEYLEAHPQVSKVYYPGLKSHPGHRFIGK
QMKAAGGVIAFEIKGSLTDGEQFIDSMKLCTLAVSLGDAETLIQHPASMTHSPYTPEERL
AAGISDGLIRLSVGLEDVNDIINDLNQAFTKIS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcatcatccacacacccaatgtatccatggtccacaaaaagccaatgatccc
catggcgcattaacctcgccattataccaaacatcgacatttcattttgaaaatgccgcc
caaggtgctgcacggtttgctggcgatgagcccggttatatttatacgcgtttgggtaac
cctaccaccactgaacttgaacaaaaagtggcgcaattagagggctgtgaggctgcagcg
gcaacggctacaggtatgggagcggtatcggcttcagtactgagctttttatcacaaggc
gatcacttagttgcatcaagtgcgctttatggttgcacctttgctttttttgcgcatatg
ttgccgcgttggggcattgaagtcacctttgtggatatgaccaatgaagatgagttacgt
gctgcaataaagccaaactcaaaaatgatatttgcagaaaccccgataaacccaacgatg
gccgttattgatttagcacttattggtgatgtagcaaaacggcataatttaataagtgtg
gtcgacaatacctttttaacgccgctgctacagtcacctaaacaatacggcatcgatatt
attatgcacagtgctaccaagtatttaaatggtcacggcgatgtagtcgcaggtattgtg
tgtggatcccttgagcacattacacatattaaaatgacggtgttaaaagatataggcgcg
acgattagcccacacgatgcatggttaattaaccgaggtttaaaaacattagctatacgg
gtagagcgtcattgccagagtgcgcaaacgattgctgaatatttagaggctcaccctcaa
gtgagtaaagtgtactatcctggactgaagtcgcacccaggtcatcggtttattggtaag
caaatgaaagctgctggcggtgttattgcttttgaaattaaagggagtttaaccgacggt
gagcagtttattgatagcatgaagctatgtactttagcggttagcttaggcgatgccgaa
acacttattcaacaccctgcatcgatgacccattcgccttacacacccgaagaaagatta
gcagccggaattagtgatggtttaattcgcttatctgttgggcttgaagatgttaatgat
attattaacgatctcaaccaagcatttactaaaatatcgtaa

DBGET integrated database retrieval system