KEGG   Pseudoalteromonas tetraodonis: PTET_b0420Help
Entry
PTET_b0420        CDS       T05282                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ptd  Pseudoalteromonas tetraodonis
Brite
KEGG Orthology (KO) [BR:ptd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PTET_b0420 (ahpF)
Enzymes [BR:ptd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PTET_b0420 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored Thi4 NAD_binding_9 NAD_binding_8 FAD_binding_3 K_oxygenase Glutaredoxin FMO-like Thioredoxin_9 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ATD05090
UniProt: A0A290TLN0
LinkDB All DBs
Position
II:389522..391099
Genome map
AA seq 525 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVESLANDLASLSDKFSVINNPDTSA
RRPSMVVHSPEKNTHITFAGVPMGHEFTSLVLALLHTGGHPSKASKDDIEQIQTLEQTLN
FEVYISLSCQTCPQVVQALNTMAATNSNIKATMIDGALFQDEVEQRNILAVPAVYLNGEP
FSQGAMSLTDILNKVDSKGAQRQAASLNEKSVFDVLVVGGGPAGASAAIYSARKGLNTGV
VAERFGGQVADTLAIENFISIKATQGPKMVAQLEEHVKEYDVDVMHNQRAANLQKGSNGY
DITLENGAVLKAKSLVLATGARWREMNVPGEQQYKGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKANSLKNITIIKNAQTTEVLGDGKK
VTGLSYTDRLSGESKQLNLAGIFVQIGLIPNTEWLKDSELELSQFGEILIDAKGATSLQG
VYAAGDATTTPFKQIIIAMGAGATASLGAFDYLIRQTPDAEQSAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaacaacataaagaaccaactaaaaagccattttgaatcgctgactcagcct
gttgagctgcttatcgccttggacgacagcaaaaaatcaacagaagtagaaagtctagca
aacgatttagcgtcactaagcgataagtttagtgtaataaataatcccgatactagcgcc
cgcaggccttctatggtggtgcattcaccagaaaaaaacacccatattacctttgcaggt
gttcctatgggacacgaatttactagtttagtgttagcgctattacatacgggtggtcac
cctagtaaagcaagtaaagatgacattgaacaaatacaaacacttgaacaaacacttaat
tttgaagtgtatattagcttgagttgccaaacctgcccgcaagttgtgcaggcacttaat
actatggcagcaacaaatagtaatattaaagccaccatgattgatggggcattatttcaa
gatgaagttgagcaaagaaacatactggcggtacccgctgtttatttaaatggtgaacct
tttagccaaggggccatgagcctcactgatattttaaataaagtggatagcaaaggtgca
cagcgccaagcagcatcactcaatgaaaagtcggtgtttgatgtacttgtcgtcggtggt
gggccagctggtgcttcggcagctatttattcagcacgtaaagggctcaatactggggtt
gtagcagagcgatttggcggtcaagttgctgatacattagcgattgaaaactttatttca
ataaaagcaacgcaagggccaaaaatggtggctcagttggaagaacacgttaaagaatac
gatgttgatgttatgcacaaccaacgcgcggcaaacctgcaaaaaggcagtaatgggtat
gatattacgctagaaaatggcgctgtattaaaagcaaaatcactcgtgctagcaaccggt
gcacgctggcgcgaaatgaatgtacccggtgagcaacaatataaaggccatggcgttgca
tactgcccgcactgtgatgggcctctatttaaaggtaaaccggttgcggttattggtggt
ggtaattcaggtattgaggcggcaattgatttagccaatatagttgaacacgttactgta
cttgaatttgctgatacgttacgcgccgatgaggtacttattcgtaaagctaatagctta
aaaaacatcactattattaaaaacgcccaaaccacggaagtacttggtgatggcaaaaaa
gtaacggggttaagttataccgaccgccttagcggcgagagtaaacagttgaacttagcc
ggtatatttgtacaaattggtttaatacctaataccgaatggttgaaagacagcgagctt
gaactgagccaatttggtgaaatactcattgatgccaaaggcgcaacatcgttacaaggc
gtttatgctgcaggtgatgcaaccactacgccatttaagcaaattattattgcgatgggg
gcgggcgcaacagcaagcctaggtgcgtttgactatttaattcgtcaaacgcccgatgca
gagcaaagcgctgcttaa

DBGET integrated database retrieval system