KEGG   Pyrenophora teres: PTT_07092Help
Entry
PTT_07092         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pte  Pyrenophora teres
Pathway
pte00020  Citrate cycle (TCA cycle)
pte00310  Lysine degradation
pte00380  Tryptophan metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01200  Carbon metabolism
Module
pte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTT_07092
  09105 Amino acid metabolism
   00310 Lysine degradation
    PTT_07092
   00380 Tryptophan metabolism
    PTT_07092
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PTT_07092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: EFQ95025
UniProt: E3RGX3
LinkDB All DBs
Position
Unknown
AA seq 1043 aa AA seqDB search
MLRNTLRQCSRQLLSTPAKASFSSLAQPSRAAISTCRRPLALAQRRQYAVSSGDTNKGVD
PNDSFLQGNTANYIDAMYMQWKQDPSSVHYSWQVYFHNMESGDMPVSQAFQPPPNIMSSP
QGATHKPGMGMAAAEGTEVMNHLKVQLLVRAYQARGHHKAKIDPLGIRSEAEQFGYSKPR
ELELSHYNFTDKDLEQDIELGPGILPRFRTESRKKMKLKEIIEACERLYCGSYGIEYIHI
PDREQCDWLRERIEVPTPFKYSVDEKRRILDRLIWGTNFEAFLATKYPNDKRFGLEGGES
LIPGMKALIDRSVDFGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAEANEEGSG
DVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAILHYNNDEKDATSAMG
VLLHGDAAFAAQGVVYETMGFHQLPSYHTGGTIHIIVNNQIGFTTDPRFSRSTPYCSDIA
KAIDAPVFHVNGDDVEALNFVCQLAADFRAEFKKDVVIDMVCYRKQGHNETDQPFFTQPL
MYKKISQQPQTLDIYTKKLLEEKTFTKEDIDEHKAWVWGMLDESFSRSKDYVPNSKEWLT
SAWNGFKSPKELATEVLPHLPTAIEESQLKHIAEKIGNAPEDFNVHKNLKRILAGRTKTV
MDGKNIDMATAEALAFGSLCMEGHHVRVSGQDVERGTFSQRHAVLHDQETEKTYTPLQDL
SKDQATFTISNSSLSEYGVLGFEYGYSLSSPNALVMWEAQFGDFANTAQVIIDQFIASGE
VKWLQRSGLVMSLPHGYDGQGPEHSSGRMERYLQLCNEDPRIFPSPDKLDRQHQDCNMQI
AYTTKPSNLFHLLRRQMNRQFRKPLILFFSKSLLRHPIARSNIEEFTGDSHFQWIIEDPA
HATGEIESHEGINRVIICTGQVYAALVKEREARGEKDVAITRIEQLNPFPWQQLKDNLDS
YPNAQNIIWCQEEPLNAGAWSFTQPRIETLLNETEHHNRRHVMYAGRNPSASVATGLKVS
HKNEEKALLEMAFTVKQDKLKSE
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaacaccctgcgccaatgctcccgccagctgctgagcacgccggcaaaagca
tccttctctagcctcgcacagccatcgagggctgccatttcgacatgtcgcaggcctctg
gcacttgcgcagcgccgccaatatgcagtttcctcgggagacaccaacaagggcgttgac
cccaacgactcgtttcttcaaggcaacacggcaaactacatcgatgccatgtacatgcag
tggaagcaggacccctcaagcgtccactactcatggcaggtctacttccacaacatggag
tctggcgacatgcctgtgtcgcaagccttccaaccgccgcccaacatcatgagctcgccc
cagggcgccacccacaagccaggaatgggcatggccgccgcagaaggcaccgaggtcatg
aaccatctcaaggtccaattgcttgtgcgagcctaccaggcccgcggtcaccacaaggca
aagatcgacccgctgggcattcgctcagaggccgagcaattcggatacagcaagccgcgc
gagctcgagctgtcgcactacaactttaccgacaaggatctggagcaagatatcgagctg
ggcccgggtatcttgccgcgcttcaggaccgaaagccgcaagaagatgaagctaaaggag
atcattgaagcctgtgagcgtctctactgcggttcctatggtattgaatacatccacatc
ccggacagggagcagtgcgactggctccgtgagcgcatcgaagtccccaccccattcaag
tactccgtcgacgagaagcgccgaattctggaccgcctcatctggggcacaaacttcgag
gctttcctggctaccaaataccccaacgacaagcgcttcggtctagagggtggtgagagt
ttgatcccgggaatgaaggccctgattgaccgaagtgtcgactttggcgtcaaggacatc
gtcattggcatgccgcatcgtggacgtctcaacgtgctttccaacgttgtcaggaagccc
aacgagtccatcttcagtgagtttgctggtactgccgaagccaacgaagagggctctggt
gatgtcaagtaccatttgggcatgaactttgagcgccccacgccatctggaaagcgtgtc
cagctctccctggtcgctaacccgtcccatttggaggccgaggaccccgttgttcttgga
aagacccgcgccattctacactacaacaatgatgaaaaggatgccaccagcgccatgggt
gttcttctgcacggtgatgctgctttcgccgcacagggtgttgtatacgagaccatgggt
ttccaccagctccccagctaccacactggtggaactatccacatcatcgtcaacaaccag
attggtttcactacggatcccagattctctcgttccactccatactgctcggatatcgcc
aaggccattgatgcacctgtcttccatgtcaacggtgatgatgtcgaggcgctcaacttc
gtttgccagcttgcagccgacttccgtgctgagttcaagaaggatgtcgtaattgacatg
gtctgctacaggaagcagggtcacaatgagactgaccagcctttcttcactcaacccttg
atgtacaagaagatctctcagcaaccgcaaacactagacatctacaccaagaagcttcta
gaagaaaagactttcaccaaagaggacattgacgagcacaaggcctgggtctggggtatg
ctagatgagagtttcagccgcagcaaggactatgtgcccaactccaaggagtggctcact
tccgcctggaacggcttcaagtcgcccaaggagctcgctaccgaagtcctacctcatcta
ccaactgcaatcgaggagtctcaattgaagcacattgccgagaagattggaaacgcaccc
gaggacttcaacgtacacaagaacttgaagcgtatcttggctggtcgcacaaagactgtc
atggacggcaagaacatcgatatggctaccgcagaagcattggctttcggaagtttgtgc
atggagggccatcacgtccgtgtctccggacaagatgtcgagcgtggaaccttctcccag
cgccatgctgtgcttcacgaccaggagacagagaagacatatacacctctgcaagacctt
agcaaagatcaggcgacttttaccatcagcaactcttccctgagtgaatacggagtgctc
ggcttcgagtacggatactcgctgtcttcccccaacgctctcgttatgtgggaggcgcaa
ttcggtgactttgccaacacggcccaggtcatcatcgatcaattcattgcttctggtgag
gtcaagtggcttcagcgttccggtcttgtaatgagcttgccgcacggttacgacggtcag
ggacccgaacattcctcgggacgtatggagcgctatctacaactgtgcaatgaggacccg
cgtatcttcccatcgccggacaagcttgaccgtcaacaccaggactgcaacatgcagatt
gcttacaccacgaagccatcgaacctcttccaccttctccgtcgtcagatgaaccgtcaa
ttccgcaagccgctcattctcttcttctccaagtcgcttctccgacacccgattgcgcga
tccaacattgaagaattcactggagactcccacttccagtggatcatcgaagacccggca
cacgcgactggtgagattgagtcgcatgagggaatcaaccgggtcatcatttgcacaggt
caggtttatgcagcactagtcaaggagcgtgaagcccgtggcgagaaggacgttgcaatt
acacgcattgaacagctgaacccgttcccatggcagcagctcaaggacaacctcgactcg
taccccaacgcacagaacattatctggtgccaagaagagccactcaatgctggtgcatgg
agcttcacccagcccaggattgagacacttctcaacgagacggagcaccacaacaggagg
cacgtcatgtacgcgggacgcaaccccagtgcatccgtcgccactggtctcaaggtgtcg
cacaagaacgaggagaaggcgctgctggagatggcctttacggtcaagcaggacaagttg
aagagcgagtag

DBGET integrated database retrieval system