KEGG   Pyrenophora teres: PTT_07502Help
Entry
PTT_07502         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pte  Pyrenophora teres
Pathway
pte00020  Citrate cycle (TCA cycle)
pte00480  Glutathione metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01200  Carbon metabolism
pte01210  2-Oxocarboxylic acid metabolism
pte01230  Biosynthesis of amino acids
pte04146  Peroxisome
Module
pte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pte_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTT_07502
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PTT_07502
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PTT_07502
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PTT_07502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: EFQ94718
UniProt: E3RHS9
LinkDB All DBs
Position
Unknown
AA seq 416 aa AA seqDB search
MASSAGITKIKVKNPVVELDGDEMTRIIWQVIKDKFIHPYLDIDLKYYDLGLPYRDETND
QVTLDAAEAIKKYSVGVKCATITPDEQRVEEFKLKKMWLSPNGTIRNHLGGTVFRAPIVI
PTIPRLVPGWKQPIIIGRHAFGDQYRAKDRVIPGEGTLEMVFTPKGGKPEVIKVYDFPAE
GGVAQTQYNTTESITGFAHASFKMALDKKLPLYMSTKNTILKAYDGKFKDVFQAIYESQY
KKDFEAAKIWYEHRLIDDMVAQMIKSEGGYIIAMKNYDGDVQSDIVAQGFGSLGLMTSTL
ITPDGKTFEAEAAHGTVTRHFREHQKGKETSTNPIASIYAWTQGLAKRGELDNTPELVVF
AEQLEKACVDTVDIDKIMTKDLALACGKKDRASWVTTNEYLDAVERRLKSSLKEKL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctgcgggaatcaccaagatcaaggtcaagaacccggtggtggagttggac
ggcgatgagatgaccaggatcatttggcaggttatcaaggacaagtttatccatccctac
ctcgacatcgacctcaagtactacgaccttggacttccctaccgcgacgagacaaacgac
caggtgactctcgatgccgccgaagcgatcaagaaatactcagtcggtgtcaaatgcgcg
actatcacgccggatgagcagcgagtggaggagttcaagctcaagaagatgtggctgtcg
ccaaacggcaccatccgaaaccacctaggaggaaccgtcttccgcgcgcccattgtcatc
cccaccatccctcgcctcgtacccggctggaagcagcccatcatcatcggccgtcatgct
tttggcgaccagtatcgcgcaaaggaccgcgtcattcccggcgagggaacactagagatg
gtcttcacacccaagggcggcaagccagaggtcatcaaggtctacgacttccctgccgag
ggcggcgttgcgcagacccagtacaacacaacagagtccatcaccggtttcgcgcacgca
tccttcaagatggcgcttgacaagaagctgccgctgtacatgagcaccaagaacaccatc
ctcaaggcatacgacggaaagttcaaggatgtcttccaggccatctacgagagccagtac
aagaaggactttgaggcggccaagatctggtacgagcaccgcttgatcgacgacatggtc
gcccagatgatcaagagcgagggtggctacattattgccatgaagaactacgatggagac
gtgcagtccgacattgttgcccaaggtttcggctctctcggcctcatgacatccaccctc
atcacccccgacggcaagacgttcgaggccgaagccgcccacggcaccgtcacccgccac
ttccgcgagcaccaaaagggcaaagagacctcaaccaaccccatcgcctccatctacgcc
tggacacaaggtcttgccaagcgtggtgagctggacaacacacctgagctcgtcgtgttt
gccgagcagcttgagaaggcctgcgttgacacggtcgacattgacaagatcatgaccaag
gacttggcgctggcttgtgggaagaaggacagggcgtcttgggttactaccaacgaatac
cttgatgctgtagagaggaggctcaagtcgagcttgaaggaaaagctatga

DBGET integrated database retrieval system