KEGG   Pyrenophora teres: PTT_08052Help
Entry
PTT_08052         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pte  Pyrenophora teres
Pathway
pte00250  Alanine, aspartate and glutamate metabolism
pte00410  beta-Alanine metabolism
pte00430  Taurine and hypotaurine metabolism
pte00650  Butanoate metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
Module
pte_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PTT_08052
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTT_08052
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTT_08052
   00430 Taurine and hypotaurine metabolism
    PTT_08052
Enzymes [BR:pte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PTT_08052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: EFQ94305
UniProt: E3RIY7
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MVHINRVATSKEITEEKAQFEEISASTTINLSPEDEADDYTATVYGSKYAAEDLPRHEMP
DREMPPSIAYRLIKDDLTLDGTPTLNLASFVTTYMEDEAEKLMVDAFSKNFIDYEEYPVS
ADIQNRCVSMIAKLFHAPADADANTIGTSTIGSSEAIMLGVLAMKKLWQNKRKAEGKPFD
KPNMIMNSAVQVCWEKACRYFDIEEKYVYCTTDRYVIDPKECVDLCDENTIGICAILGTT
YTGEYEDIKAINDLLVERDIDVNIHVDAASGGFVAPFVNPDLLWDFRLPKVTTINVSGHK
YGLVYPGVGWVVWRDPAHLPQELVFTINYLGADQASFTLNFSRGASQIIGQYYQLIRLGK
RGYRRIMLNLTRISDYLAANLESLGFVIMSQRGGQGLPLVACRIDEDLGKMYDEFAIAHQ
LRERGWVVPAYTMAPHSEKMKMLRVVVREDFTKSRCDALIADFKLALQTLDALDAKKIED
QKQHAFAMRRRSTLVSPIFKKNAADHFDEEHSLQAKTGKTHAVC
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatatcaaccgtgtagccacctccaaggagattaccgaagagaaggctcaattc
gaggagatctcggcctctactaccatcaatctctctccagaagatgaggccgacgactac
acggcgactgtctatggtagcaaatatgccgctgaagatctgccgagacatgagatgccg
gatcgagagatgccgccttcgattgcctaccgactaatcaaggacgacctcaccctcgac
ggtactcccactttgaatttggcctctttcgttactacgtacatggaagatgaagctgaa
aagctcatggtcgacgctttctcaaagaacttcatcgactacgaagagtaccccgttagc
gccgacatccaaaaccgatgtgtctccatgatcgcaaagcttttccatgccccggccgac
gcggatgcgaacacaatcggtacttcgacaatcggatcgtccgaggccatcatgctggga
gtcctagccatgaaaaaactatggcagaacaagcgcaaggcggagggcaagccgttcgac
aagcctaacatgatcatgaactcggccgtacaggtctgctgggaaaaagcatgtcgctac
ttcgacattgaagaaaagtatgtgtactgcacaactgatcgttacgtgatcgaccctaaa
gagtgtgtcgatctttgcgacgagaacaccattggaatttgcgcaatcctgggaacaacc
tataccggcgagtacgaggacatcaaggccatcaacgacctcctcgttgagcgcgacata
gatgtaaatattcacgttgatgctgcatcaggtggctttgtcgccccattcgtgaacccc
gatctactttgggatttccgcttacccaaggtcaccaccatcaatgtcagtggccataaa
tacggactcgtgtacccgggtgttggctgggtcgtctggcgtgaccccgcacacctgccg
caggagcttgtattcactatcaactaccttggtgcggaccaagcttcgttcacgctgaac
ttctctcgcggagcatcgcaaatcatcgggcagtactaccaactcattcgacttggaaag
cgcggatacaggaggataatgctcaacctgacgcgtatttcggattaccttgccgcgaac
ctggaatcattaggctttgtgatcatgagccagaggggaggacagggtcttcctcttgtt
gcttgccgtatcgatgaagatctaggcaagatgtacgacgagttcgccatcgcacatcaa
cttcgtgagcgtggatgggtcgtacctgcctacaccatggccccacactcggaaaagatg
aagatgctacgtgttgtagtgcgcgaagatttcacaaagtctcgctgcgatgccctgatt
gcagatttcaagcttgccttgcagaccctcgacgcccttgatgctaagaaaattgaggac
caaaagcaacatgcatttgctatgcgccgccgctcgacgctcgttagcccaatcttcaag
aagaatgccgctgaccatttcgatgaggagcatagtctgcaggctaagactggaaagaca
catgctgtgtgctaa

DBGET integrated database retrieval system