KEGG   Pyrenophora teres: PTT_08464Help
Entry
PTT_08464         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pte  Pyrenophora teres
Pathway
pte04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pte00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PTT_08464
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PTT_08464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu COXG
Motif
Other DBs
NCBI-ProteinID: EFQ94039
UniProt: E3RJV3
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLRGDSNVKGTVTFEQADENSQTTISWNITGNDANAERGMHVHAFGDNTNGCTS
AGPHFNPHGKEHGAPEDDERHVGDLGNFKTDGQGNAQGSVTDKLIKLIGPDSVIGRTVVV
HAGTDDLGKGGHAESKKTGNAGGRPACGVIGVSA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagccgtcgctgtcctccgtggtgactccaacgtcaagggtaccgtcaccttt
gagcaagccgacgagaactcacaaaccaccatctcatggaacataactggcaacgacgcc
aacgctgagcgtggtatgcacgttcacgcctttggtgacaacaccaacggctgcacatcc
gccggccctcacttcaacccccacggcaaggaacacggggccccagaagacgatgagcgc
catgttggtgacttgggtaacttcaagactgacggccagggcaatgctcagggaagcgtc
acagacaagttgatcaagttgatcggccccgacagcgtcattggccgtaccgtcgtcgtc
catgccggtaccgacgatcttggcaagggtggccacgcggagtctaagaagactggcaac
gctggtggccgccccgcttgtggtgtcattggtgtctcagcctag

DBGET integrated database retrieval system