KEGG   Pyrenophora teres: PTT_10029Help
Entry
PTT_10029         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pte  Pyrenophora teres
Pathway
pte00052  Galactose metabolism
pte00511  Other glycan degradation
pte00600  Sphingolipid metabolism
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PTT_10029
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PTT_10029
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PTT_10029
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PTT_10029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Peptidase_M20 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 Big_1 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: EFQ92818
UniProt: E3RN93
LinkDB All DBs
Position
Unknown
AA seq 1288 aa AA seqDB search
MVGPSRMLYNSYKFLVLGLMASVFFDASAAHTIKKTRDASAGRQRTSLNANWRFERFTSN
PDGLSYDILKPWIMPVANEFLSGKKYDRPSGDAPGANVSYVQSSFDDAAWEAVTLPHDWA
ISGTFNAPGVSGDLGFLPINGVGWYRRMVSMDAEIISSGKSVYLDVDGAMAYAAVWLNGQ
LVGGWPYGYNSFRLDLTPYAKAGDNTLAIRLDNKLESSRWYPGAGIYRNIWLVTVSPVHV
GHYGTYITTPSVSTTEATVNIVLDIENKGNSSQSVEVVTEIYERDATTKKATGACVATFP
TAKADVAGLTKHSVNGSVVVTNPKLWGPLPEQTPNEYIAISTVSVNGMSVDTYETNFGIR
SIRLDKDHGVFINGKYTYVKGTCNHHTLGSLGAAWNTRAAERQIEALQEMGNNALRTSHN
PPAAEFLDLADSMGLMVMDEMYDTWSFGKVDNDFHLIFPEWHEPDLRSFIRRDRNHPSII
SWSIGNELPDQKNSSGTATGKALQDIAHEEDPTRLVTLGMNNASPDTGLAAEIDIIGLNY
QGEGKGTSWRSTFPGFHEKFPEKMIWSTESSSCVSSRGVYIFPVTANKSAIVGGHTGEGG
DMVNSQVSSYDLYAPEWASSPDKVFEMQDRHPYVAGEFVWTGWDYIGEPTPYSNTSKSSF
FGIIDLAGFKKDRFYLYQARWRSDLPMAHILPHWTWPEDRVGEITPVHVYTSGDEVELFV
NGVTAGRQTRGKYDYRLRWDGIQYKHGNVTAVAYKNGTEWARDTKLTAGAAKSLNVTADR
TTIAADGYDLSFVSVEVLDANGTLVPMANHAITFEVTSGPGMIISTDNGDPTDLVPFPEL
TRKAFNGMALAIVQGKADNTGEIIIEAKAEGLKSGKVVVKTTKEDIHYTAQWSAPSPGGL
TRLCADANDKKVRDWFREQVLALGAEYKVNATGTQFALVRGEDSSIPPIAMGSHLDSVAT
GGKFDGPLGVLGGLEVLRSMREQGIKTRAPLVLINWTNEEGARFFPPLGSSSVYAGKTSV
AQAHASTSNDHSGLTMGGELAKIGYVGSGPNLFAEFHISAHFEIHVEQSTDLEKAGKPVG
WVEGWQGMTWYSLQLTGEDGHANTYKMDRRRDALVGAAKIITAVDETAYKYNGGSTVTNI
LSGPWGSCNIQSSTCLSFCLMNRDATLLDTMGADLEMRIREIAAKQKLELTMKRDIHLYP
GKFWPEAVDCVKRACGNKGIASRTGTGHDSTMTTLLVPTAMVFVRAKGGVSHCAQEWSSE
EDCGEGALALGRAVLNFDEVLRGKMVEV
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcccatcgaggatgctgtacaattcgtacaaattcctggtgctgggcttgatg
gcctcggtgtttttcgatgcttcggccgcacatacaatcaagaagacgcgcgacgcgtct
gcaggacgtcaacgcacatctctcaatgctaactggcgttttgagcgctttacgtctaat
cccgacggcttgagctatgacatcctgaagccatggatcatgcctgtggcgaacgagttc
ctcagcggaaagaagtacgatcgtccttccggagatgcgccgggcgcaaatgtcagctat
gtacagtcaagctttgacgacgcagcctgggaggctgtcaccctgccacatgactgggct
atctcggggactttcaacgctcctggtgtgtcgggtgatctggggtttcttccgatcaat
ggagttgggtggtaccgccgcatggtctcaatggatgccgaaatcatcagttctggcaaa
tcggtctacttggacgtggacggggccatggcatatgccgcggtgtggttgaacggccag
ctcgttggtggatggccttatgggtacaactccttccgcctcgatcttacaccatacgcc
aaggcgggagacaacacgctcgccatccgacttgataacaaattagaatcctcgcgttgg
tacccgggtgcgggaatctatcgcaacatctggcttgtgaccgtcagtccggttcatgtc
ggacactatggaacctacatcaccaccccaagtgtttcgactaccgaggccactgtcaac
atcgttcttgatatcgaaaataagggaaacagcagccaaagcgtcgaggtggttactgag
atttatgagcgcgacgctacgacgaagaaggccacgggtgcttgcgttgctaccttccca
acagcgaaggcagatgtggcaggtcttacgaaacactctgtgaatggctccgttgtggtc
actaacccaaagctctggggcccattgccggaacagacacccaacgagtacattgcgata
tccaccgtgtcagtcaacggcatgtcggtggacacttacgaaaccaactttggtatccga
tcaattagattagacaaggaccacggagtattcattaacggaaaatacacctacgtcaaa
ggtacttgcaaccatcacacacttggctcgctgggtgcggcgtggaacacacgagccgcc
gagcgccagatcgaagccttgcaggaaatgggtaacaatgctcttcgcacttcgcataac
ccacccgcggctgaattccttgatctcgcagatagcatgggcttgatggttatggatgag
atgtacgacacgtggagcttcggtaaagtcgataatgactttcacctaatattccctgag
tggcatgaaccggatctacgatcattcattcgtcgtgatcgaaatcacccatccatcatt
tcctggagcatcggaaacgagctccccgatcagaagaattcttctggtaccgcgaccgga
aaggcactccaagatattgctcacgaagaagatcccacgcgtttggtaacacttggcatg
aacaatgctagtccagacacaggtctagctgccgagatcgacatcattggcctcaactac
caaggagagggtaaggggacatcctggcgcagtacttttcctgggttccatgagaaattc
cccgaaaaaatgatttggagcactgaatcttcatcctgtgtcagctctcgtggcgtctac
attttcccagttacggccaacaagagcgccattgttggcggacacaccggcgaaggtggt
gatatggtaaacagccaagtcagctcatacgacctgtacgcaccggaatgggcatcctct
ccagacaaagtctttgaaatgcaagacaggcacccctacgttgcgggtgaatttgtttgg
acgggatgggattacattggagaaccgacgccatactcgaacacctccaaaagctctttc
tttggcatcatcgatctcgcaggcttcaagaaagaccgcttttacctttaccaagcacgc
tggcggtctgatctccccatggcgcacattcttccacattggacttggccagaagaccgg
gttggagagataactcccgtgcacgtctacacctctggcgatgaagtagaactcttcgtc
aacggcgttactgccggacgacagacaagagggaaatacgactacaggcttcgatgggac
ggtatccaatacaagcatggaaacgtcactgccgttgcctacaagaacggcactgagtgg
gctagggatactaagctcacagctggcgctgcaaagtcgctcaatgtgaccgcggatcgc
accaccatcgctgcagatggatacgatctctccttcgtcagcgttgaagtacttgatgcc
aatggcaccctggtccccatggcgaaccacgcgattacttttgaggtaacgtctggcccg
ggtatgattatcagcacggataacggcgacccaacggatctagtgccatttcctgagttg
actaggaaagcgttcaacggtatggcgttggcgattgtacagggaaaggctgataacact
ggggagatcattattgaggctaaggcggaaggattgaagagtggaaaggttgtggtgaaa
actacgaaggaggacatccactataccgcccaatggagcgccccctccccaggcggtcta
acccgcctctgcgccgacgccaacgacaaaaaagtgcgagattggttccgcgagcaggtc
ttggctctgggagcagaatacaaggtcaatgctacagggacacagtttgcattggtgcgg
ggcgaggatagtagtataccgcctatagccatggggtcgcatctggatagcgtggctact
ggggggaaatttgacggaccgcttggtgtacttggtggtctcgaagtcctccgctctatg
cgcgaacaaggtatcaaaacccgtgctcccctcgttttgatcaactggacaaacgaagaa
ggtgcgcgtttcttcccacctctaggaagttcatccgtatacgcggggaaaacctcagtc
gcccaagcccacgcgtcaacctcaaacgaccactccggcctgaccatgggcggcgaacta
gcaaagatcggatacgtaggctcaggtccaaatctcttcgccgaattccatattagcgcg
cacttcgagatccatgtcgagcaatccacggacctcgagaaggcagggaaacccgtaggc
tgggtagaaggctggcagggcatgacatggtattcactccaactaaccggtgaagacggt
cacgcaaacacatataaaatggaccgtcggcgggacgcgctagtcggcgccgcgaagata
ataactgcagtcgatgaaaccgcctacaagtacaacggcggctcaaccgttaccaacatc
ctttccggcccgtggggctcctgcaacatccagtcttccacttgcctctccttctgcctt
atgaacagggacgccacgctcctcgacacaatgggcgccgacctcgaaatgcgtattaga
gaaatcgctgccaagcagaaattggaattgacaatgaagcgggatatacatctctatccg
ggaaaattttggcccgaggctgtggattgcgtgaaaagggcttgtgggaacaagggaatt
gcgagtcgtacggggacagggcatgatagtacgatgacgacgctgttggtgccgacggcg
atggttttcgtaagggcgaaggggggtgttagtcattgtgcgcaggagtggagtagtgaa
gaggattgtggcgaaggggcactggcgttggggagggcggtgctgaattttgatgaagtg
ttgagggggaagatggtggaggtgtga

DBGET integrated database retrieval system